(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0968

AL596167.LIN0968     Location/Qualifiers
FT   CDS_pept        27133..28023
FT                   /transl_table=11
FT                   /gene="lin0968"
FT                   /note="similar to ribosomal large subunit pseudouridine
FT                   synthetase"
FT                   /db_xref="GOA:Q92D52"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D52"
FT                   /protein_id="CAC96199.1"
FT                   /translation="MFLEWQVKNEEDGLLLRTFLKSKHISKQLLTAVKFGADGKIEVNN
FT                   EEQNVLYHVKTDDKVRLTFPTEQQNDRLLAEHTDLEVVFEDDFLLIINKPAGMASIPSQ
FT                   YHPTGSVANFVKGHYENQGLTSAIHIVTRLDRETSGLMLIAKNRYAHARLSSFLQQGLL
FT                   KRRYQAFTSGTLEEEAGSIEAPIGRKDVSIMERFVTPEGKYAKTNYEVLMRYNGFDHLA
FT                   IQLETGRTHQIRVHFSYIGHPLIGDDMYGGDQELLKRQALHSCHLHLVHPVTEEYMAFD
FT                   LPLPEDMEQIIQKSK"
     gtgtttttag aatggcaagt aaaaaatgaa gaagatgggt tgttgcttag aacttttctg        60
     aaaagcaagc acatatctaa acaattatta accgcagtaa aatttggcgc ggatggtaaa       120
     attgaagtta ataacgaaga acaaaatgtt ttatatcatg ttaaaactga cgataaagtt       180
     cgacttacct ttccaacaga acaacaaaat gatcgattat tggcagaaca tacagattta       240
     gaagtagttt ttgaagatga ctttttatta attattaata aaccggccgg aatggcttca       300
     attccgtctc aatatcatcc gaccggttca gtagcaaatt ttgtaaaagg acactacgaa       360
     aatcaagggc ttacaagtgc tatccatatc gtaacaaggc ttgaccgaga aacatcagga       420
     ttaatgttaa tcgccaaaaa tagatacgca cacgccaggc tcagtagttt tttacaacaa       480
     ggactactca aaagacgata ccaagctttc acttcaggta ccctggaaga agaagcagga       540
     tctattgaag caccaatagg acgtaaagat gtaagtataa tggagcgttt tgttactcca       600
     gaaggaaaat atgcgaaaac aaactacgaa gttctcatgc gttataacgg gtttgatcat       660
     ttagcgatcc agcttgagac agggcgaaca catcaaattc gggtgcattt ttcttatatc       720
     ggtcatccgc ttattggcga tgacatgtac ggcggggatc aggaactact taaaagacaa       780
     gcacttcact cttgtcatct acatttagtc cacccagtca cagaagaata tatggcgttt       840
     gatttgcctt taccagaaga tatggaacag ataattcaaa aatcgaagta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page