(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0969

AL596167.LIN0969     Location/Qualifiers
FT   CDS_pept        28101..28889
FT                   /transl_table=11
FT                   /gene="lin0969"
FT                   /note="similar to enoyl- acyl-carrier protein reductase"
FT                   /db_xref="GOA:Q92D51"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D51"
FT                   /protein_id="CAC96200.1"
FT                   /translation="MNLSLEGKTYVVMGVANKRSIAWAIARSLNEAGAKLVFTYADDRA
FT                   KKSITELVPSLNEINQDPLILACDVTSEDAITATFETIKDKAGKLSGLAHCIAFANKDY
FT                   LTGDYLEVDRKSFLQAHEISAYSFTAVARALKHLDMLTEDASLLTLTYLGGERVVENYN
FT                   IMGVAKASLDASVRYLAMDLGAIGVRVNAISAGPIRTVSARGVSGFSDSISLVEERAPL
FT                   KRATQAEEVGDTAYYLFSNLSRGVTGEVIHVDSGYHIIGF"
     atgaatttat cattagaggg aaaaacatat gttgtaatgg gagtagctaa taaacgcagt        60
     attgcttggg cgattgctcg ttcattaaat gaagcaggag caaaactagt atttacatat       120
     gcggatgatc gtgcgaaaaa aagcattact gaactagtac cttcattaaa cgaaataaat       180
     caagatccac ttattttagc atgtgatgta acaagtgagg acgctattac agcgacattt       240
     gaaacaatta aagataaagc aggcaaactt agtggtttag cacattgtat tgcttttgct       300
     aataaagatt acttaactgg tgactattta gaagtagatc gtaaaagctt cttacaagcg       360
     catgaaatca gtgcttattc gtttacagcg gtggcgcgtg cgttaaaaca cttagatatg       420
     ttaactgaag atgctagctt gcttacttta acttatcttg gcggtgagcg tgttgtagaa       480
     aactacaata tcatgggtgt tgctaaagct tctcttgatg ctagcgtgag ataccttgca       540
     atggacctag gagctatcgg agtgcgtgtg aatgctattt ctgctggacc aattagaaca       600
     gtctcagcac gtggcgttag cggcttctct gactcgattt cacttgtaga agaaagagca       660
     ccattaaaac gtgcaacaca agcagaagaa gtaggagata cagcttatta cttattcagt       720
     aacttatcac gaggcgtaac aggtgaagta attcatgtgg atagcggtta tcatattatt       780
     ggattctaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page