(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0975

AL596167.LIN0975     Location/Qualifiers
FT   CDS_pept        complement(34271..34708)
FT                   /transl_table=11
FT                   /gene="lin0975"
FT                   /note="similar to B. subtilis YjcF protein"
FT                   /db_xref="GOA:Q92D45"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D45"
FT                   /protein_id="CAC96206.1"
FT                   /translation="MTVKKVTDELGKQAALKIRNDVFVVEQNVDPALEWDEFDEMASVD
FT                   MFVDYAEDGTALATGRFRVKDGYGKVERICTQKIARGSGSGRRIMEAIELEAKTRGLTT
FT                   LKLGAQLTAIPFYEKLGYETCSDVFLDAGIKHKEMKKTLTY"
     ttgacggtaa aaaaagtaac agatgaacta ggtaaacaag cagcactaaa aattcgaaat        60
     gacgttttcg ttgtcgaaca aaatgtagat cctgcattag aatgggatga atttgatgaa       120
     atggcttcgg tggatatgtt tgttgattac gctgaagacg gcacagcgct cgcgacaggc       180
     agatttcgcg taaaggatgg ttacggtaaa gtcgaacgca tttgcaccca aaaaatagcc       240
     cgtggctccg gcagtggacg tagaatcatg gaagctattg aactggaagc taaaacgcgt       300
     ggattaacaa cactaaaatt aggcgcccag ttaacagcaa tcccctttta tgaaaaactt       360
     ggctatgaaa cgtgctctga tgtattctta gatgcaggaa ttaaacataa agaaatgaaa       420
     aaaacattaa cttattaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page