(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0976

AL596167.LIN0976     Location/Qualifiers
FT   CDS_pept        complement(34725..35474)
FT                   /transl_table=11
FT                   /gene="lin0976"
FT                   /note="similar to B. subtilis YjcH protein"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D44"
FT                   /protein_id="CAC96207.1"
FT                   /translation="MTAHKMLDEKFYSKLLGEELDLIICLPPDFSPLYKYPLFIVQDGK
FT                   DYFQFGKLARHSEELAVNEQIQKAIFIGIPYKTVMDRREKYHPDGEQNEAYIRFLAFEL
FT                   VPYLEERFPSFQMPTSRFLMGDSLGASVSLKAALLFPFTFGNVILHSPYVDDAILTLAE
FT                   KADPAKVKIYHIIGDQETAVETTGDEILDFLSPNKSLEQILTSRGFDYYFRVFNGDHRW
FT                   KYWQPFIKESLQFMLPVNTFDLESMRA"
     atgacagctc ataaaatgtt agatgagaaa ttttacagta aattgctagg agaggaactc        60
     gatttaatta tttgcttacc acctgatttt tcgccacttt acaaatatcc tttatttatt       120
     gtacaagatg gaaaagatta ttttcagttt ggtaaacttg cgcgtcactc ggaagaatta       180
     gcagtaaacg agcagattca aaaagccatt ttcattggta ttccttacaa aactgtcatg       240
     gatcgccgag aaaagtatca tccagatggt gaacaaaatg aagcatacat ccggttctta       300
     gcattcgaac ttgttcctta tcttgaagaa cgcttccctt ctttccaaat gccaacgagt       360
     agatttctta tgggtgactc ccttggtgca tctgtttcat taaaagccgc actactattt       420
     ccgtttacgt tcggtaatgt tatcttacat tctccttatg tcgatgatgc aatccttaca       480
     ttagcagaaa aagctgaccc tgccaaagta aaaatctacc atattattgg cgaccaagaa       540
     actgcagttg aaactactgg agatgaaata ctcgattttc tatcaccaaa caaatcttta       600
     gaacaaattt taacctctcg tgggtttgat tattatttcc gcgtatttaa cggcgatcat       660
     cgctggaaat actggcagcc atttattaaa gaatccttac aatttatgct tccagtaaat       720
     acgtttgatt tagaaagcat gcgcgcatag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page