(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0977

AL596167.LIN0977     Location/Qualifiers
FT   CDS_pept        35693..36712
FT                   /transl_table=11
FT                   /gene="lin0977"
FT                   /note="similar to branched-chain amino acid
FT                   aminotransferase"
FT                   /db_xref="GOA:Q92D43"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D43"
FT                   /protein_id="CAC96208.1"
FT                   /translation="MSKDIDWSNLGFSYIKTDKRYISHWKDGAWDEGTLTEDNTLHISE
FT                   GSTALHYGQQCFEGLKAYRCKDGSINLFRPDRNAARIQKSCERLLMPHIPTEKFIDACM
FT                   QVVRANEEFVPPYGTGATLYLRPFVIGVGDNIGVHAAPEYIFSVFCSPVGPYFKGGMAP
FT                   TNFIVSDFDRAAPNGTGAAKVGGNYAASLLPGQNAKDRNFGDCIYLDPATHTKIEEVGS
FT                   ANFFGITKDDKFITPYSPSILPSITKYSLLYLAEHRLGLKAEEGDVFIDKLDEFKEAGA
FT                   CGTAAVITPIGGIQTKDDFHVFYSETEVGPVTKRLFDELCGIQFGDVEAPEGWIYKVK"
     atgagtaaag atattgactg gagtaattta gggtttagtt atattaaaac ggacaagcgt        60
     tatatttcac attggaaaga cggagcgtgg gatgaaggta ctttgacgga agataataca       120
     cttcatatta gtgaaggttc tactgcactt cattatggcc aacaatgttt tgaaggtttg       180
     aaagcatatc gttgtaagga tggttccatt aacctttttc gtccagatcg taatgctgct       240
     cgtattcaaa aaagttgtga acgtttatta atgcctcata ttccaacaga aaaatttatt       300
     gatgcttgta tgcaagttgt tcgtgcaaat gaagaatttg ttccacctta tggtactgga       360
     gcaactcttt atttacgacc gtttgtaatt ggcgtaggtg ataatattgg cgttcatgca       420
     gctccagagt atattttctc tgttttctgt tcaccagttg gtccttattt caaaggcgga       480
     atggcaccaa ctaactttat cgtttctgac tttgaccgtg ccgctccaaa tggaacaggt       540
     gcagcaaaag taggcggtaa ctatgcagca agtttacttc cagggcaaaa cgcaaaagat       600
     cgtaattttg gggattgtat ctacttggac ccagctactc atacaaaaat tgaagaagtt       660
     ggctcggcta atttctttgg tattacaaaa gacgataaat ttattacgcc gtattctcct       720
     tctattttgc caagtatcac gaagtattca ttactttatt tggcagaaca ccgtttaggt       780
     ttaaaagcag aagaaggcga tgtatttatt gataagttag atgaatttaa ggaagcaggc       840
     gcatgtggaa ccgccgcagt tatcacacca attggcggta ttcaaacaaa agatgacttc       900
     catgtatttt acagtgaaac agaagtaggg ccagtaacaa aacgcctatt tgatgaacta       960
     tgtggaattc aatttggaga tgtagaagct ccagaaggtt ggatttataa agtgaaataa      1020
//

If you have problems or comments...

PBIL Back to PBIL home page