(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0985

AL596167.LIN0985     Location/Qualifiers
FT   CDS_pept        42626..43537
FT                   /transl_table=11
FT                   /gene="lin0985"
FT                   /note="similar to antibiotic ABC transporter, ATP-binding
FT                   protein,"
FT                   /db_xref="GOA:Q92D35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D35"
FT                   /protein_id="CAC96216.1"
FT                   /translation="MIKLTNVVKTFGKVEAVKGINLEVEKGSLFAFLGENGAGKSTTLS
FT                   MICTESEPTSGEIFIDDEKLTFKNRKNFRQKLGVVFQENVLDDLLTVRENLYNRASLYG
FT                   KTKAEITERLELVSSIMGIEDILNRRFEKLSGGQKRRAEIARAIMHDPEILLLDEPTTG
FT                   LDPKTRVSVWKIIDYLREEFGMTVFLTTHYLEEAKDADQLAVIHKGNIIAQGTPANIRS
FT                   RFSVDKIFFYDANVEELQVIIEKANLPYKVSKGTIRVDVIDENIGILAILNQAAGLYSS
FT                   FEVIKGNLDDAFISMIKEDSND"
     atgataaaat taacgaatgt agttaaaacg tttggaaaag tagaagcagt taaaggcatt        60
     aatttagaag tcgaaaaagg ttcgttgttt gcattcttgg gtgagaacgg ggcggggaaa       120
     tcgaccacgc ttagcatgat ttgcacagaa agcgagccaa catctggaga aatttttatt       180
     gacgatgaaa aattgacctt taaaaatagg aaaaatttca gacaaaagtt gggcgttgtt       240
     tttcaagaaa acgtgttgga cgatttactt accgtgcgtg agaatctgta taatcgtgcc       300
     agtttatatg gaaaaacaaa agcggaaatt accgaacgtt tagagcttgt ttcttctatt       360
     atgggaattg aggatatctt aaatcgccgt tttgaaaaac tatcaggggg acaaaaacgc       420
     cgagctgaaa ttgctagggc tattatgcat gatccagaaa ttttactact cgatgaaccg       480
     actactgggc tggatccgaa aactcgagtg agcgtttgga agattattga ttatttgcga       540
     gaagaattcg gcatgacggt gtttttaacg acgcattatt tagaagaagc gaaggatgcg       600
     gatcagctgg cagttattca taagggaaat attatcgctc aaggcactcc cgctaatatt       660
     agaagtcgtt tttcagtaga taaaatcttc ttttatgatg caaatgtgga agaacttcag       720
     gtaattattg aaaaagcaaa tttaccttat aaagtgtcaa aaggaacgat acgtgttgac       780
     gtaatagatg aaaatatcgg aattttggct attttgaatc aagcagcggg actttatagt       840
     tcttttgaag taataaaagg aaatcttgat gatgcattta tctcgatgat taaggaggat       900
     tcaaatgatt ag                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page