(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0986

AL596167.LIN0986     Location/Qualifiers
FT   CDS_pept        43530..44384
FT                   /transl_table=11
FT                   /gene="lin0986"
FT                   /note="similar to Streptococcus agalactiae CylB protein"
FT                   /db_xref="GOA:Q92D34"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D34"
FT                   /protein_id="CAC96217.1"
FT                   /translation="MISRNLKIYFRDRTAVFMSLLTILIIIGLYAIFLGNNMEEMFKQA
FT                   SGKTIGIQELVNTWVIAGILSITPVTVSLAVFSLKVHDEEQSIARSFAITPASRWRIVA
FT                   SYIVSGLVASFVLSVITLFVGEMYIWLTGGAFLPLESWVSLIGIILINVLCCSSIMFFI
FT                   ASLVKKASAFSSVSTIVGTVIGFIAGIYLPIGSLPAAVQTAMKCFPFTYGASTIREIMT
FT                   KEPLQQVFAGNTQAMDATKEMIGITIYWGDKTVTTGVSLLILSVFAVLFGILSVVLMKR
FT                   QTK"
     atgattagtc gtaatttaaa aatctatttt cgtgatagaa ctgcggtatt tatgtcgcta        60
     ctcacgattt taattattat cggactctat gccatttttt taggaaataa tatggaagaa       120
     atgtttaagc aggcttctgg aaaaacgatt ggaatacagg aattagtgaa tacgtgggta       180
     attgcgggga ttttgtctat tacgccggtc actgtttctt tagctgtttt ctcattaaaa       240
     gtgcacgatg aagagcagag tattgccaga agttttgcaa taactccagc ttccagatgg       300
     cgaattgtcg caagctacat cgttagtggt ttagttgctt catttgtttt gtcagttatc       360
     actctttttg ttggtgaaat gtacatctgg ttgacaggag gagcattttt accgcttgaa       420
     agttgggtta gtttaatcgg cattatttta attaatgttc tatgttgtag tagcataatg       480
     ttttttatcg caagcttagt gaaaaaagcg agcgccttta gttcggtttc gactattgtt       540
     ggaactgtta tcggttttat tgctggaatt tatttgccga ttggttcgct tcctgctgcg       600
     gttcaaacgg cgatgaaatg ttttcctttc acatacgggg cgtctactat tcgtgaaatc       660
     atgacaaaag agccattgca acaagttttc gcaggtaata ctcaggcgat ggatgcgaca       720
     aaagaaatga ttggtattac tatttattgg ggtgataaaa cagtaacgac aggagtaagt       780
     ttgctgattt taagcgtctt tgcagtgctt tttggcattt tatctgtcgt cttaatgaaa       840
     cgacaaacaa aataa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page