(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0987

AL596167.LIN0987     Location/Qualifiers
FT   CDS_pept        44466..46034
FT                   /transl_table=11
FT                   /gene="lin0987"
FT                   /note="similar to peptide chain release factor 3 (RF-3)"
FT                   /db_xref="GOA:Q92D33"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D33"
FT                   /protein_id="CAC96218.1"
FT                   /translation="MSQDLQKEVASRKTFAIISHPDAGKTTITEQLLLFGGVIRSAGTV
FT                   KGKKSGKFATSDWMEIEKQRGISVTSSVMQFDYNGSRINILDTPGHSDFSEDTYRTLMA
FT                   VDSAVMVIDAAKGIEAQTLKLFKVCRMRGIPIFTFINKMDRQGKMPLELLAELEEVLGI
FT                   ESYPMNWPIGMGKELAGIYDRYHRVIEQYRSEEDERFLPLGEDGDLKEVHAIQKSLYYD
FT                   QALEEIMLLDEAGNDFSRERIIAGEQTPVFFGSALTNFGVETFLRTFVDFAPSPSSHES
FT                   NEGVIEADNPKFSGFIFKIQANMNPAHRDRIAFIRICSGEFERGMNVTLTRTGKSMKLA
FT                   NSTQFMADDRETVNRAVAGDIIGLYDTGNYQIGDTITNGSKKLEFEKLPQFTPELFMRV
FT                   YAKNVMKQKHFHKGVEQLVQEGAIQLFKTWRTEEYIIGAVGQLQFEVFEHRMRGEYNSE
FT                   IRMEPIGKKIARWVKEEDADEKLSTARSMLVKDRFDQPLFLFENEFAINWFNDKNPDIE
FT                   LTSLL"
     atgagtcaag atttgcaaaa agaagttgct tcacgcaaaa cgtttgcgat tatttctcac        60
     ccggatgctg ggaaaacgac gattactgag caattactat tattcggtgg cgttatccgt       120
     tcagctggga ctgtaaaggg aaagaaatct ggcaagtttg cgacaagtga ctggatggaa       180
     attgaaaaac aacgtggaat ctcggtaacg agttctgtga tgcagtttga ttataatggt       240
     tcaagaatta atattttgga tacaccgggt cactctgact tcagtgaaga tacgtaccga       300
     accttaatgg cggttgatag tgctgtcatg gttattgatg ctgcgaaagg tatcgaagcc       360
     caaacgctaa aactgtttaa agtttgtcgg atgcgcggaa ttccaatttt tacttttatt       420
     aataaaatgg accgtcaagg aaaaatgcca ctagaactac ttgctgaatt agaagaagtt       480
     ttgggtattg aatcttatcc aatgaactgg ccaattggta tggggaaaga attagctggt       540
     atttatgacc gctatcatcg cgttattgag caatatcgct cagaagaaga tgaacgtttc       600
     ttaccacttg gggaagatgg agatttgaag gaagtacacg ctattcaaaa atcactttat       660
     tacgatcaag ctttagaaga aatcatgctg ttagacgaag cgggaaatga ctttagtcgg       720
     gaacgcatta ttgcaggcga gcaaacacca gtatttttcg gaagtgcctt aactaacttt       780
     ggggtagaaa ctttcttgcg tacatttgtt gattttgcac catctccttc aagccatgaa       840
     tcgaatgaag gcgtgattga agctgataat ccgaagttct ctggctttat ttttaaaatc       900
     caagcgaaca tgaaccctgc tcaccgggac cggattgctt ttattcgaat ttgttcaggc       960
     gaatttgaac gcggcatgaa cgttacatta acgcgaactg ggaaaagtat gaagcttgcg      1020
     aactcaacgc agtttatggc ggatgaccgg gaaactgtta atcgtgcggt agctggtgat      1080
     attatcggtt tgtacgacac gggtaattac caaattggcg atacgataac gaatggcagt      1140
     aaaaaactcg aatttgaaaa acttcctcag tttacaccag aattatttat gcgtgtttat      1200
     gcgaaaaatg taatgaagca aaaacacttt cataaaggcg tagagcaact cgttcaagaa      1260
     ggtgcgattc aattatttaa aacgtggcgc acggaagaat acattattgg ggctgttggt      1320
     cagttgcaat ttgaagtatt cgaacacaga atgcgcggcg aatataattc tgaaatccgg      1380
     atggagccaa tcggtaaaaa aatcgctcgt tgggtgaaag aagaagatgc ggatgaaaaa      1440
     ctatctaccg ctagaagtat gctagtgaaa gaccgttttg accaaccgct attcttattc      1500
     gaaaacgaat tcgcgattaa ttggtttaat gataaaaatc cagatattga gttaacttca      1560
     ttactataa                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page