(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0989

AL596167.LIN0989     Location/Qualifiers
FT   CDS_pept        46622..47983
FT                   /transl_table=11
FT                   /gene="lin0989"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q92D31"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D31"
FT                   /protein_id="CAC96220.1"
FT                   /translation="MKHSDNYYLTKASIPKAIAHLSIPMMLGMSVGVIYNIINAFFIGL
FT                   LHDTSMLTAVTLGLPMFTILMAIGNMFGVGGGTYISRLLGKEDGIKAKQVSAFVLYGSL
FT                   VLGIICAIILGFLINPVTHFLGADATSFLHTKNYTLALLICSPFIIANFALEQVVRAEG
FT                   ASRISMNGMLIGTLVNLVFDPLLILYFNFNVVGAAVSIGIASTVSLIYYAWYLEKKSDY
FT                   LSIRFKWFKATKEIVQNVFKIGVSELLLSLFLIVTTLVLNHYSMIYGEGVVAGFGVALR
FT                   VVQLPEFICMGLYMGIIPLLAYNFSAGNIARFEKAIRFTAVSIGLIVLVISSFVFIFRF
FT                   QVMHLFSDSQSVISLGVHIMVAMLISSLFSGFTGLFTSTFQAIGKAIPATIMSVSQGII
FT                   FIPVIILGQHYFGLMGVIWSLTTTEILTCLIGVILFTIHNIKIASSAKTKDLAV"
     atgaaacact cagataacta ttatttaaca aaagcgagca ttcctaaagc gattgctcac        60
     ttatctattc caatgatgct tgggatgtcc gttggggtca tttataatat tatcaatgca       120
     ttctttatag ggttgttgca tgatacgtcg atgttaacag ctgtgacact cggtttacca       180
     atgtttacga ttttaatggc tattgggaat atgtttggtg ttggcggcgg gacgtacatt       240
     tctcgtttac tcgggaaaga agacgggatt aaggcaaagc aagtatcggc ttttgtttta       300
     tatggaagtt tggttttagg tattatatgc gcgattatat taggcttttt aattaatcca       360
     gttactcatt ttctaggagc agacgcgaca agttttttac acacgaaaaa ttatacattg       420
     gcgcttctca tttgtagtcc gtttattatt gctaactttg ctttagaaca agtcgttcgg       480
     gcggagggag cttctcgtat ttctatgaat gggatgctta ttggtacgct tgtaaattta       540
     gtgtttgatc cactgcttat tttgtatttt aattttaacg ttgtaggtgc tgcagtttca       600
     attggaattg caagtacggt ttcacttatt tattatgcct ggtatttgga gaaaaaaagt       660
     gactatttat ccattcggtt taaatggttt aaagcaacga aagaaatcgt tcaaaatgtt       720
     tttaaaattg gcgtttcaga actactttta tcattattct tgattgttac tacacttgtt       780
     ttaaatcatt attcgatgat ttacggggaa ggcgttgttg caggttttgg ggtggcacta       840
     cgagtagttc agttaccaga atttatttgt atggggcttt atatgggaat tattccactc       900
     ttagcatata actttagtgc gggaaatatt gcacggtttg aaaaagcgat taggtttaca       960
     gctgttagta ttggcttgat tgtgcttgtg atttctagtt ttgtatttat tttccgtttc      1020
     caagtgatgc atctatttag tgacagtcaa agtgttatat cacttggggt gcatattatg      1080
     gttgcgatgc tgatttcttc tctattcagt ggttttactg gtctctttac gagtactttt      1140
     caagcgattg ggaaagctat tccggctacg attatgtctg tttcacaagg aattattttt      1200
     atcccagtaa ttattttggg acaacattat tttggcctaa tgggcgtgat ttggtcttta      1260
     acaacaacag aaattcttac ttgtttaatc ggtgtgattc tattcacaat ccataatatt      1320
     aaaatagcca gtagcgcaaa aactaaagac ttggcggttt aa                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page