(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0990

AL596167.LIN0990     Location/Qualifiers
FT   CDS_pept        48264..49031
FT                   /transl_table=11
FT                   /gene="lin0990"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q92D30"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR013055"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D30"
FT                   /protein_id="CAC96221.1"
FT                   /translation="MDTAMILEYGWVLLVLIGLEGILAADNAVVMAVMVKHLPDKQQKK
FT                   ALFYGLMGAFVFRFGALFLISFLANVWQVQALGAAYLLYIAISHIWKHAKGKDGEKEKK
FT                   EKAGSGFWMTVLKVEIADIAFAIDSMLAAVALAITLPETGWGHIGGIDTGQFAIMFLGG
FT                   LVGLIIIRFAATQFVKLLKSYPSLETAAFLIVGWVGVKLVIYTLAHPSLGVIPHSFPES
FT                   TLWKLIFWGVMILIILWGWFVSYRSKKKTETTK"
     gtggatacag caatgatttt agagtacgga tgggtattac ttgtcctaat cggtcttgag        60
     gggattttag cagcggataa tgcagtagtt atggctgtta tggtaaaaca tctcccagat       120
     aaacaacaga aaaaagcgtt attttatgga ttgatgggtg cctttgtttt ccgttttggc       180
     gcattattct taatttcctt tttggcaaac gtttggcaag ttcaagcgct tggtgccgca       240
     tatttactat atatcgcgat tagtcacatt tggaaacatg caaaaggaaa agacggagaa       300
     aaagagaaga aggaaaaagc tggctctggt ttttggatga cagttctaaa agtagagatt       360
     gcagatattg cgtttgcgat tgattccatg cttgcggcag tagcccttgc cattacgctt       420
     ccagaaacag gatggggaca cattggggga attgataccg ggcaatttgc gattatgttc       480
     ttaggtggac ttgttggcct aattattatc cgttttgcag caactcaatt tgttaaatta       540
     ctaaaaagct atccaagtct cgaaacagcc gcatttttaa ttgttggttg ggtaggcgtg       600
     aagctagtta tttatacatt agcacaccct agtcttggcg taattccaca cagcttccct       660
     gaatcaacac tttggaaatt gattttctgg ggcgtgatga ttctgattat tctatgggga       720
     tggttcgttt cctaccgtag taagaaaaaa acagaaacaa ctaaataa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page