(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0991

AL596167.LIN0991     Location/Qualifiers
FT   CDS_pept        49136..49903
FT                   /transl_table=11
FT                   /gene="lin0991"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q92D29"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D29"
FT                   /protein_id="CAC96222.1"
FT                   /translation="MDVSIWGEYALVFLVLVVLEGILSADNAVVMAVIVKGLPHDKQRK
FT                   ALFYGLVGAFVFRFVALFLISFLVKIWEIQAIGAVYLLYLAIKHMWRLKKGKQEEVKEA
FT                   SEAKSTSFWGVVARVELTDIAFALDSMLAAAALVVTLPDLGNFDIGGMNGGQFIVMFLG
FT                   GIAGLVVIRFAATQVVKLLERYPTLETAAFLIVGWVGVKMAVLTLAHPSVAIIPEDFPD
FT                   SAVWKLTFWSVMIIIGLGGYIIARKKEKKTKRV"
     atggatgttt ctatttgggg agaatatgcg ttagttttcc ttgttttagt tgtacttgaa        60
     ggaattcttt ccgcagataa tgccgtagtt atggcagtaa ttgttaaagg tttaccgcac       120
     gataaacaac gaaaagcctt attttatggg ttagttggtg catttgtttt ccgttttgtt       180
     gcactatttt taatttcatt tttagtaaaa atttgggaaa tacaagctat cggcgcggtt       240
     tatttattgt acttagcaat caagcatatg tggcgcctta aaaaaggtaa gcaagaagaa       300
     gtcaaagaag catcagaagc caaatcaact tccttttggg gtgtagttgc acgtgtggaa       360
     ttgacagata tagcttttgc actggattcc atgttagctg cagcagcact tgttgttact       420
     ttaccagatt tagggaattt tgatattggg ggaatgaacg gtggacaatt tatcgtgatg       480
     ttccttggtg gtattgcagg acttgttgta attcgttttg cagccacaca agttgttaaa       540
     ttattagagc gttaccctac acttgaaaca gcagcgtttt taattgtcgg ttgggtaggt       600
     gtgaaaatgg cggtcttaac gctagcacat ccatctgttg caattattcc agaagatttt       660
     ccggattcag cggtttggaa gctgacattc tggtcggtta tgataattat aggtttgggt       720
     ggttatatca ttgcgagaaa aaaagagaag aaaaccaaaa gagtttga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page