(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0992

AL596167.LIN0992     Location/Qualifiers
FT   CDS_pept        49944..51281
FT                   /transl_table=11
FT                   /gene="lin0992"
FT                   /note="similar to Na+-transporting ATP synthase subunit J"
FT                   /db_xref="GOA:Q92D28"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D28"
FT                   /protein_id="CAC96223.1"
FT                   /translation="MLARMTPVQVIIAYYFIAVTISTIVLSLPFTLQKGVKVSFIDTLF
FT                   TAASSVSVTGLATVDVSQTYSTAGIWVLMAIFQIGGLGVMMISTFFYLILKRRIGLKQR
FT                   QLIMTDTNQFTMSGMVRMLREILVLIFGIELVGALILGIYFIPLYPNFWEAMFQGLYNS
FT                   VSLVTNAGVDITGKSLIPFANDYFVQFISILLIIAGAIGFPVLLETRRFLFEKNTLIPF
FT                   RFSLFVKVTTLTYFVLLIVGGLLIWLFEYNHFFSGKSWDFGFFNSMFLSATSRSAGLQT
FT                   MDSGALSVSTLLLVSFLMFIGASPSSVGGGIRTTTFAITILFIYSVIRGRKHVYIFGRE
FT                   LHQEDVRKSLAVTLVAGFLSISAIVILMQTETASLISVIFEVFSAFGTSGLSVGLTPDL
FT                   STPGKLIIIVLMFIGRVGIMYSMLSLRNKNQPKNAIRLPKEKIITG"
     gtgttagcgc gtatgacacc cgttcaagta attatcgcgt attattttat tgcggttacg        60
     atttctacta tcgtcttaag tttgccgttc actttacaaa aaggggttaa ggtgtcgttt       120
     attgatactt tattcacagc ggcgagttct gttagtgtta ccgggcttgc gacagtagat       180
     gttagccaga cgtatagtac tgctggaatt tgggtcttaa tggcgatttt ccaaattggt       240
     ggattgggcg ttatgatgat tagcacgttc ttctatttga ttttgaagag acggattgga       300
     ctgaaacagc gccaacttat tatgacagat acgaatcaat ttacgatgag tggaatggtt       360
     cggatgttgc gcgaaattct tgtcttgatt tttggaattg aattagtggg cgcgttgatt       420
     ttagggattt attttatccc tctgtatcct aatttttggg aagcgatgtt ccaaggttta       480
     tataactcag tttcgcttgt taccaatgct ggtgtggata ttactggtaa atcgctaata       540
     ccattcgcaa atgattattt tgtccaattt atttcgatat tactaattat tgctggtgcg       600
     attgggtttc cggttttact ggaaacaaga cgatttttat ttgagaaaaa tacgctaata       660
     ccgtttcgtt tttcgttgtt tgtaaaggtg actacactta cttattttgt acttttgatt       720
     gtcggcggct tactcatttg gttgtttgaa tacaatcact tctttagtgg caaaagttgg       780
     gactttggtt tctttaactc gatgttctta tcggcgacat ccagaagtgc tggactccaa       840
     acaatggaca gcggggcgct ttcagtttct acccttttac ttgtgtcgtt cttgatgttt       900
     atcggagctt cgccaagttc tgttggtggt gggatacgaa cgactacttt tgcgattacc       960
     attttattta tttattcggt tattcgcggt cggaagcatg tttatatttt tgggcgagaa      1020
     ttgcatcaag aagatgttcg caagtcgctt gcagtcacgc ttgttgcagg atttctcagt      1080
     atttctgcga tagtcatact catgcaaaca gaaacggcct cgctcatttc agttattttt      1140
     gaagtgttct cggcgtttgg aacgtcaggt ttatcagttg gtttgacgcc tgatttgtcc      1200
     accccaggta aattaattat tatcgtcttg atgttcattg gacgggttgg catcatgtat      1260
     tcaatgctta gtttaagaaa taaaaatcaa cccaaaaatg ccattcgatt accaaaagaa      1320
     aaaattatta ctggctaa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page