(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0994

AL596167.LIN0994     Location/Qualifiers
FT   CDS_pept        complement(51761..52792)
FT                   /transl_table=11
FT                   /gene="lin0994"
FT                   /note="similar to B. subtilis YkrP protein"
FT                   /db_xref="GOA:Q92D26"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D26"
FT                   /protein_id="CAC96225.1"
FT                   /translation="MEQTEIKRESYFDNAKFILIFLVVFGHFLQTFITEYAGVRVLYIY
FT                   IYTFHMPAFILISGFFAKSFGKPGYLKKTMKKLILPYVFFQLIYSIFYYFLLNKENLSI
FT                   KFLDPEWSLWFLLSLFFWNLMLLVFSKIKPWKSVSIALLLGLVAGYFDIIGGYLSLSRT
FT                   LVFFPFFLVGYFLKKEHFYFLKTHIASIVGGIFVVLLLIFITMHPNLNDKWFLGSKPYA
FT                   NFVEVKSLGLFIRALVYMISFCSIAAFFSFIPQKRLFFTKWGKNTLYVYLLHGFFIKFF
FT                   REGGQTDFQYSPSTFLLLFGITFGLTVLLSSRLVKTVVQPVIELRASMLYNVFSRLTKR
FT                   ESY"
     atggagcaaa ccgaaatcaa acgggaaagt tacttcgata atgctaagtt tattttaatt        60
     ttcttagtcg tattcgggca ttttcttcaa acatttatta cagaatatgc tggggttcgt       120
     gtcctttaca tttatattta cactttccat atgcctgcct ttatactaat ctctggtttt       180
     tttgctaaaa gttttggtaa gccaggatat ttaaaaaaga cgatgaaaaa attaatttta       240
     ccatatgttt ttttccaact aatctacagt attttttatt attttctttt aaataaggag       300
     aatctttcta ttaaattttt agatccagaa tggtcgcttt ggtttttact cagtttattt       360
     ttctggaatt taatgttgct tgttttttca aaaatcaaac cttggaagtc tgtgagtatt       420
     gcgcttttat taggactggt tgctggatac tttgatatta ttggtggtta tttaagttta       480
     tctagaaccc ttgtcttctt cccattcttc ttagtaggct actttttaaa aaaggaacat       540
     ttttactttc ttaaaacgca tatagcttct atcgttgggg gaattttcgt tgtattatta       600
     ctgattttta ttaccatgca tccgaatcta aacgataaat ggtttttagg atcaaaacca       660
     tatgctaact ttgtcgaagt gaagtcgctt ggtcttttca ttcgcgcgct cgtctacatg       720
     attagttttt gctctatcgc tgcttttttc agttttatcc cacaaaaaag gttatttttt       780
     actaaatggg gtaaaaatac gttatatgtt tatttgttac atggcttctt tattaagttc       840
     tttcgtgaag gtggccaaac tgactttcaa tatagcccgt ctacgttttt actattattt       900
     ggaattactt ttggtttgac ggtgttatta tccagtcgat tggtaaaaac agttgttcag       960
     ccagtgattg agctgcgtgc ttcaatgctc tataacgtgt ttagccgatt aacaaagcgg      1020
     gaaagttatt aa                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page