(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0995

AL596167.LIN0995     Location/Qualifiers
FT   CDS_pept        52980..53459
FT                   /transl_table=11
FT                   /gene="lin0995"
FT                   /note="similar to methylated-DNA-protein-cystein
FT                   methyltransferase "
FT                   /db_xref="GOA:Q92D25"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D25"
FT                   /protein_id="CAC96226.1"
FT                   /translation="MLKQTSDSPVGTLFIIIEDAHITKISYDEPTNWEILAGEKGEIAI
FT                   YQQLLEQLAGYFEGEREVFDLPIFLQGTPFQQRVWQALSEIPYGVVVSYKDIAIAAGSP
FT                   KAVQAVGQANRANPIPILIPCHRCVKSDGALGGYNGADIDKKQYLLALEKGLRLS"
     atgttgaaac aaacaagcga ttcgccggtg ggtacgttgt ttatcataat agaggatgcg        60
     catattacaa agatttcata cgatgagccg actaattggg aaattttagc gggagagaag       120
     ggcgagatag caatatatca gcagcttcta gaacaattag caggttattt tgaaggagag       180
     cgggaagtat ttgatttacc aattttcttg caaggaactc cttttcaaca gcgtgtttgg       240
     caagcactta gtgaaattcc atacggggta gttgttagtt ataaagatat agcaatagct       300
     gctgggagtc caaaagcagt gcaagcagtg gggcaagcta atcgcgctaa tcctattcct       360
     atacttattc catgtcatag gtgtgtgaaa agtgatgggg cgcttggtgg gtataacgga       420
     gcggacattg ataagaagca atatttactt gcattagaaa aaggcttgcg tttaagttaa       480
//

If you have problems or comments...

PBIL Back to PBIL home page