(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN0997

AL596167.LIN0997     Location/Qualifiers
FT   CDS_pept        complement(55813..56424)
FT                   /transl_table=11
FT                   /gene="lin0997"
FT                   /note="similar to hypothetical protein"
FT                   /db_xref="GOA:Q92D23"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D23"
FT                   /protein_id="CAC96228.1"
FT                   /translation="MKSIKIDYKLVLGLILCALLVILTYQFPRVFWYLYGAGMLFLLSF
FT                   VIFNDDLKKEFSFVKGILPGIFSGIVLYIIFYIGAFIIKVMPGGLEHSVEAAFNKYSTH
FT                   SLVIWLLLIVAIIPGEEIFWRGFVLKRLNHYFNHWFSNIFAALLCMVMMLPSGNFAAII
FT                   GIFVASLVWNVMYSYRPSLLMVYLSHLTFAFLLLAALPIY"
     ttgaagagca tcaagattga ttataaactc gtattgggac ttattttatg tgccctactt        60
     gttatattaa catatcagtt cccacgtgtt ttttggtatt tatatggagc tgggatgtta       120
     tttttactta gttttgtgat atttaatgac gatttaaaaa aggaattttc gttcgttaaa       180
     ggcattttac ctggaatttt ttccggaatt gtcctttata ttatttttta cataggtgcc       240
     tttattatta aagtaatgcc aggtggtcta gaacattctg tagaagctgc atttaataag       300
     tattccaccc actctttagt aatatggttg cttttgattg tcgcgattat ccccggtgaa       360
     gaaattttct ggcgtggatt tgtattaaaa cgtttgaacc attattttaa tcattggttc       420
     tctaatattt ttgccgcctt actatgtatg gtcatgatgt tgcctagtgg taattttgcc       480
     gctatcatcg gtatttttgt tgcatctctt gtatggaatg tgatgtactc ttatcgcccg       540
     agccttctca tggtttatct gtcgcatttg acctttgcct ttttattact cgcggcattg       600
     ccaatttatt aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page