(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1000

AL596167.LIN1000     Location/Qualifiers
FT   CDS_pept        complement(58943..59212)
FT                   /transl_table=11
FT                   /gene="lin1000"
FT                   /note="similar to B. subtilis protein YkvS"
FT                   /db_xref="InterPro:IPR018690"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D20"
FT                   /protein_id="CAC96231.1"
FT                   /translation="MHTFFFIKINATPKIEGVITMAKAHVGDIIEFKDGLTGIVEKLNE
FT                   NSVIVDLTYMENFKDLGIEEKTVVNHKNYQIIHSVEEDEEETEE"
     atgcatacat tctttttcat caagataaac gcaacaccga aaattgaagg agtgataaca        60
     atggcaaagg cacatgttgg agacattatt gaatttaagg atggcttaac aggaattgtt       120
     gaaaagctca acgaaaattc tgttattgtc gacttaactt atatggaaaa ttttaaagat       180
     ttaggtattg aagaaaaaac agtggtaaat cacaaaaatt atcaaattat tcattctgta       240
     gaagaagacg aagaagagac agaagaataa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page