(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1002

AL596167.LIN1002     Location/Qualifiers
FT   CDS_pept        59787..61505
FT                   /transl_table=11
FT                   /gene="lin1002"
FT                   /product="phosphotransferase system enzyme I"
FT                   /db_xref="GOA:Q92D19"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D19"
FT                   /protein_id="CAC96233.1"
FT                   /translation="MAKELKGIAASDGIAIAKAYLLVEPDLSYEKTEVTDVESEVKRFE
FT                   SALEVSRTELSTIREKAAKDLGEDKAQIFDAHLLVLNDPELTGPIEESIKNAKTNAETA
FT                   LQETTDMFIGMFESMDNEYMRERAADIKDVRKRVLSHLLGVTIPNPALIDEEVVVVAAD
FT                   LTPSDTAQLNRKFVKGFVTDIGGRTSHSAIMARSLEIPAVVGTKEVTASVAKNDIVIID
FT                   GLEGNVIIHPTEEQIAHYEKIKSDFALQQAEWEKLKNEKTVSKDGVHVELAANIGTPND
FT                   LEGVISNGGEAVGLYRTEFLYMGRDNFPTEEEQFEAYKAVVSGMDGKSVVVRTLDIGGD
FT                   KTLPYLELPEEMNPFLGFRAIRLCFANEELFRTQLRALLRASVYGNLKIMFPMIATVNE
FT                   FRQARDILLDEKAKLKAAGTEVSDSIELGIMIEIPAAAVLADQFAKEVDFFSIGTNDLI
FT                   QYTMAADRMNERVSYLYQPYNPSILRLVKMVIDASHKEGKWTGMCGEMAGDQTAVPLLL
FT                   GLGLDEFSMSASSILKSRSLIKRLDQSEMVKLAEEALNKSTAEEVVELVEKYTAE"
     atggctaaag agttgaaagg tatcgcagca tctgatggga ttgccattgc gaaagcttat        60
     ctgctcgttg aacctgatct ttcctatgaa aaaactgaag ttacggatgt tgaaagtgaa       120
     gtaaaacgtt ttgaaagcgc gttagaagtt tctagaacag aactttcaac gattcgtgaa       180
     aaagcagcta aagacttagg cgaagataag gcacaaattt ttgacgcgca tcttctagtt       240
     ttaaacgatc ctgaattaac aggaccaatt gaagaaagca tcaaaaatgc taaaacgaat       300
     gcagaaacag ctttacaaga aacgacagac atgtttattg gtatgtttga atctatggac       360
     aacgaataca tgcgtgaacg tgcagctgat attaaagatg tacgcaaacg tgttctttct       420
     cacttactag gtgtgactat tccaaatcca gctttaattg atgaggaagt agttgttgtc       480
     gcagctgatt taacgccttc tgataccgca caacttaacc gtaaatttgt taaaggtttt       540
     gtgacggata ttggtggtcg tacttcgcat tctgctatta tggcacgctc tcttgaaatt       600
     ccagcagtag ttggaacaaa agaagtaact gctagcgtag cgaaaaacga tattgttatt       660
     attgatggtt tggaaggtaa tgttatcatc cacccaacag aagaacaaat cgctcactat       720
     gaaaaaatta aatctgattt tgctttacaa caagcagaat gggaaaaact taaaaatgaa       780
     aaaacagttt ctaaagacgg cgttcacgtt gagcttgcag caaacatcgg aactccgaat       840
     gatttagaag gtgtcatttc taatggcggg gaagcagttg gactttatcg tacagaattc       900
     ttgtacatgg gtcgcgacaa tttcccaaca gaagaagaac aattcgaagc gtataaagca       960
     gtagtttctg gtatggacgg aaaatctgtg gtagttcgta cattagatat tggtggcgat      1020
     aaaacgttac cttatttaga acttccagaa gaaatgaacc cattcctagg attccgtgca      1080
     attcgtcttt gttttgcgaa tgaagaatta ttccgtacac aacttcgcgc actacttcgc      1140
     gcaagtgtat atggtaactt aaaaattatg ttcccgatga ttgcaacagt aaatgaattc      1200
     cgccaagcgc gcgatatttt actagatgaa aaagcgaaac taaaagctgc tggaacagaa      1260
     gtatctgatt ccatcgaact tggaattatg attgaaattc ctgctgctgc agttttagct      1320
     gatcaatttg caaaagaagt tgatttcttc tcaatcggaa caaatgactt gattcagtat      1380
     acaatggctg ctgaccgtat gaatgaacgc gtttcttacc tttaccaacc atacaatcca      1440
     tctattttac gcttagtaaa aatggtaatt gatgcttctc ataaagaggg caaatggact      1500
     ggtatgtgtg gggaaatggc tggagatcaa acggctgtac cacttctttt aggcttaggc      1560
     ttagatgaat tttcaatgag tgcttcaagc attcttaaat ctcgttcgtt aatcaaacgt      1620
     ttagatcaat ctgaaatggt taaattagcg gaagaagctt taaataaatc tacagcagaa      1680
     gaagttgtag aattagttga gaaatatact gcagagtaa                             1719
//

If you have problems or comments...

PBIL Back to PBIL home page