(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1003

AL596167.LIN1003     Location/Qualifiers
FT   CDS_pept        61618..62652
FT                   /transl_table=11
FT                   /gene="lin1003"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q92D18"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D18"
FT                   /protein_id="CAC96234.1"
FT                   /translation="MVIYSLAGFFLLLFIVLSFIDRRRISNGIVLTLALFFSLLSLIYV
FT                   TLSNGNELFVSIMSTVLILLFLLIPFFIIGLATTLIMNGRLMLKREGRKLANMLPLFIG
FT                   LVIVILFIFWFGSILKNGSPILGMVVVFVMAFVGYFSFLFLSFLLSTFLYQFNFPRYNQ
FT                   DFLIVLGSGLIDGDRVPPLLASRLNRAIAFYEKQYDKKGKRATFIVSGGQGANETVSEA
FT                   RAMRDYLISKGIDENFIIMEDKSVNTLQNMQFSKAKMDAIMPTYNSLFSTNNFHLFRAG
FT                   LYARKAGLKSQGIGAKTALYYMPNALIREFIAITVMYKKVHLILLGLVVLFFVFLAIIG
FT                   ITFR"
     ttggttatct attcattagc aggatttttt cttctgcttt tcattgtttt atcttttata        60
     gatagacgaa gaataagtaa cgggattgtt ttaacacttg cactattttt ctctttactt       120
     tcccttattt acgttactct ttcaaacggg aacgaattgt ttgtttcaat tatgagtacg       180
     gtgttgattt tactgttctt acttattcca ttttttataa ttggacttgc aacaacacta       240
     attatgaacg ggcgtttaat gttaaaacgg gaaggacgaa aactcgctaa tatgctaccg       300
     ttatttattg gcttagttat cgtcatttta tttatttttt ggttcggtag tattttgaaa       360
     aacggcagcc cgatacttgg aatggttgta gtatttgtaa tggcctttgt aggatatttt       420
     tcgtttttat ttttatcatt tcttctatca acgttcctat atcaattcaa tttcccaaga       480
     tataatcaag attttcttat tgtgcttggt agtggcttga ttgatgggga tagggtgcca       540
     ccgttacttg cgagcagatt aaatcgtgct atcgcgttct atgagaaaca atatgacaaa       600
     aaagggaaac gcgctacttt catcgtttcg ggtggacagg gcgcaaatga gacggtctca       660
     gaagcaagag cgatgcgtga ctatttaatt agtaaaggta ttgatgaaaa cttcattatt       720
     atggaagaca aatcggttaa tacacttcaa aatatgcaat tttcaaaagc aaaaatggat       780
     gcaattatgc cgacatataa cagtttattt tcgactaata actttcacct tttccgagca       840
     ggtttatacg caagaaaagc tggtctgaaa agtcagggga ttggtgcaaa aacagcactt       900
     tattatatgc caaatgcctt gattcgtgaa tttattgcga ttaccgtaat gtataaaaaa       960
     gttcatttga tactacttgg cttagttgta ttgttctttg tatttttagc gataattggt      1020
     attacattta ggtag                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page