(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1004

AL596167.LIN1004     Location/Qualifiers
FT   CDS_pept        62665..63525
FT                   /transl_table=11
FT                   /gene="lin1004"
FT                   /note="similar to 3-hydroxyisobutyrate dehydrogenase (B.
FT                   subtilis YkwC protein)"
FT                   /db_xref="GOA:Q92D17"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D17"
FT                   /protein_id="CAC96235.1"
FT                   /translation="MEKIGFVGTGVMGSSMAKHLLEAGYEVHIYTRTKEKAEALLSQGA
FT                   LWESDPGSLGAKVDILISMVGYPKDVEQLYLGENGFLDNLKAGSVAIDMTTSSPALAKK
FT                   IAEAGHEKGIGVLDAPVSGGDIGAKNGTLAIMVGGAEDVFLKVKPIFEILGSSVILQGD
FT                   AGSGQHTKMVNQIAIASNMIGVTEAIIYAERAGLNPSRVLDSISGGAAGSWSLTNLIPR
FT                   VLQDDFSPGFFIKHFIKDMGIALSEAKQMGLELPGLTLAEQMYQTLAEQGLSEEGTQAL
FT                   IKYYR"
     gtggaaaaaa taggttttgt tggtactggc gtgatggggt caagcatggc taaacatctg        60
     cttgaggctg gctatgaggt gcatatttat acgcgtacga aagaaaaagc agaagcactt       120
     cttagtcaag gggcgctatg ggaatctgat ccgggctcac taggagctaa agtggatatc       180
     ttaatttcaa tggttggcta tccaaaagat gtggagcaac tatacttagg tgaaaatggt       240
     ttcttagata atttgaaagc tggttctgtt gcgattgata tgacgacctc ttcacctgca       300
     ttagctaaaa aaattgctga agcgggccac gaaaaaggga taggtgtact tgatgcgcca       360
     gtttcaggtg gtgatattgg agcaaaaaat gggacgcttg cgattatggt tggtggagcc       420
     gaagatgtat tcttaaaagt gaaaccgatt tttgaaattc ttggtagcag tgtgatatta       480
     caaggagatg ctggctctgg ccaacataca aaaatggtaa atcaaatcgc aattgcttct       540
     aacatgattg gtgtgacaga agcgattatt tatgcagaaa gagcaggact taatccttca       600
     cgcgttcttg attctatttc aggtggagca gcgggtagtt ggtcacttac aaacttgatt       660
     ccacgcgtac tacaagatga tttttcacca ggattcttta ttaaacattt tattaaagac       720
     atgggaattg ctttatctga agcaaaacaa atggggttag agcttcccgg acttaccttg       780
     gctgagcaaa tgtatcagac tttggcagaa caaggtttga gcgaggaagg tacacaggcg       840
     ctcattaaat attatcggta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page