(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1005

AL596167.LIN1005     Location/Qualifiers
FT   CDS_pept        complement(63563..64708)
FT                   /transl_table=11
FT                   /gene="lin1005"
FT                   /note="similar to aminotransferases (to B. subtilis PatA
FT                   protein)"
FT                   /db_xref="GOA:Q92D16"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D16"
FT                   /protein_id="CAC96236.1"
FT                   /translation="MTKSIRPELRDIEVSGIRTFNTRVTGIPDMIRLTLGEPDFPTPEH
FT                   VKQAAITAIQENFTNYTPNAGMPELLEAASSYFEEKYDLTYSNKEIIVTVGATEAISVA
FT                   LQTILEPGDEVILPDPIYPGYEPLIKLNKARPVKVDTTESNFKLTPEQLRAHITPKTKA
FT                   LIIPYPSNPTGVSLSKQELRDLAEVLKETGIFVIADEIYSELTYHEEHVSIAPMLRDQT
FT                   IVINGLSKSHAMIGWRIGFLLAPEKITTEMLKIHQYSVTCASSISQKAALEAITNGKDD
FT                   AFQMRTEYKTRANFTQDRLEKMGFTVIPPDGAFYFFVKLPDDITENSFDWAVRLAEEAK
FT                   VAVVPGNAFSEKGDRYFRLSYATSVNNLAEALDRMAQFLAK"
     atgaccaaat ccattcgacc agaattgcgc gacattgaag ttagtggtat cagaacattt        60
     aatacaagag ttactggtat tcctgatatg attcgtctaa cacttgggga acctgatttt       120
     ccaacgccag agcatgtaaa acaagcagcc atcaccgcca ttcaagagaa tttcaccaat       180
     tacacaccga atgcaggtat gccagaacta ctcgaagcgg cttcttcgta ctttgaggag       240
     aaatatgacc taacttatag taataaagaa atcatcgtta cagtaggtgc tacagaggct       300
     atttcagtcg cgctgcaaac tatcttagag ccaggtgatg aagttatctt acctgatcca       360
     atttatcctg ggtatgaacc acttataaaa ctaaataaag cccgcccggt caaagtagat       420
     acaacggaat ccaatttcaa attaacgcca gaacaattac gagcacatat tacaccaaaa       480
     acgaaagcac ttattattcc ttatccgtct aacccaactg gtgtctcact ttctaaacaa       540
     gaactaagag atctagcaga agttttaaaa gaaacaggta ttttcgttat tgcagatgaa       600
     atttatagtg aattaacgta ccatgaagag cacgtaagta ttgcaccaat gctccgtgat       660
     caaacaattg taatcaatgg cctatctaaa tcgcatgcaa tgattggttg gcgaatcggc       720
     ttcctactag ccccagaaaa aatcactacc gaaatgctga aaattcatca atattcggtg       780
     acatgcgcca gctcaatttc tcaaaaagca gccttagaag ccattacaaa cggaaaagac       840
     gatgcgttcc aaatgcgcac ggaatataaa acacgagcaa acttcacaca agatcgctta       900
     gaaaaaatgg gctttacagt catcccacct gatggagctt tctatttctt tgtaaaactc       960
     ccagatgaca taactgaaaa ctcctttgat tgggctgtta gactcgcaga agaagccaaa      1020
     gtagctgtcg taccaggaaa tgctttttca gaaaaaggtg accgttactt ccgactttct      1080
     tatgccactt ccgttaataa ccttgcagaa gcgttagatc ggatggctca atttttagca      1140
     aaataa                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page