(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1008

AL596167.LIN1008     Location/Qualifiers
FT   CDS_pept        65912..66364
FT                   /transl_table=11
FT                   /gene="lin1008"
FT                   /note="similar to B. subtilis YkuL protein"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D13"
FT                   /protein_id="CAC96239.1"
FT                   /translation="MISNRFGQFIDNELADSMISAEKVAHVQLGNNLEHALLVLTKCGY
FT                   SVIPVLDFEFKLHGLISAAMITDAILGLERIEFERLEDLKVEDVMQTDFPVIKDFNNNE
FT                   RIVRLLVDHPFVCVVDEDHHFEGIVTRRVVLKQVNRYIHLQVEENR"
     atgatctcta atagatttgg acaatttatt gacaatgaac tagctgattc aatgatttcc        60
     gctgaaaaag tagctcacgt gcaactgggt aataatctcg aacatgcgct acttgtatta       120
     acgaaatgcg gttattctgt tattccagta ctagactttg aatttaaact ccatggatta       180
     attagcgcag caatgataac agatgccatt ctcggactcg aacggattga atttgaacga       240
     ctagaagatt taaaagtgga agatgttatg caaacggatt tcccggtgat taaagatttt       300
     aataataacg agcgaattgt acgcttactt gttgatcatc cttttgtttg tgttgtagat       360
     gaagaccacc attttgaagg aattgtgaca agacgcgttg ttttaaaaca agtcaatcgt       420
     tatattcatt tacaggtgga ggaaaataga tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page