(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1011

AL596167.LIN1011     Location/Qualifiers
FT   CDS_pept        68060..69175
FT                   /transl_table=11
FT                   /gene="lin1011"
FT                   /note="similar to N-acyl-L-amino acid amidohydrolases"
FT                   /db_xref="GOA:Q92D10"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR023905"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92D10"
FT                   /protein_id="CAC96242.1"
FT                   /translation="MLNEFIAIRRDLHQIPETGYKELKTQAYLLDYISKLPNEFLEIKK
FT                   WRTGILVLVKGTNPGKTIGYRTDIDALPITEETGLPFESKHAGNMHACGHDLHMSIALG
FT                   VLTHFASKPAKDNLLFVFQPAEEGPGGAKPIMESAEFSEWRPDTIYGLHIAPEYKVGQI
FT                   AIKPGLLFANTSELFISFKGKGGHAAYPHLANDMVVAASAFVGQMQTIISRNIDPMDSA
FT                   VITIGRIHGGEIQNVIAETAFLDGTIRTLSPETMEIVWTRLKQLAKGWEEAYQCEVEFH
FT                   PGSDYYQVDNDPVETEEFIHFLEEQYPESYVPARSAMTGEDFGYFLSEIKGFMFWLGVD
FT                   SEYSLHHAKLSPKEEAIPFAIDVLVNFLESK"
     atgttaaatg aatttattgc cattcgacgt gatttgcacc aaattcctga aacaggatat        60
     aaagagctaa aaacccaagc ttatttactc gattatatta gcaaattacc aaacgagttt       120
     ttagaaataa agaaatggcg cacaggaatt ttagttttag taaaaggtac taatcctgga       180
     aaaacaatcg gttatcgtac ggatattgat gcgctgccta ttacggaaga gactgggttg       240
     ccatttgaat cgaaacatgc tgggaatatg catgcttgtg gacatgattt acatatgagt       300
     atagcgcttg gagtattaac gcattttgca agtaaaccgg caaaagataa cttattattt       360
     gtgttccaac cagctgaaga agggccaggc ggagcaaaac cgattatgga aagtgctgaa       420
     ttttccgagt ggcgccccga tacgatttat ggtcttcata ttgcaccaga atataaagtc       480
     ggccaaatcg caattaaacc aggcttacta ttcgcaaaca cttccgaact ctttatttca       540
     tttaaaggaa aaggcggaca tgcggcttat ccacatttgg caaatgacat ggttgtggcg       600
     gcaagcgctt ttgtcggaca aatgcaaact attattagtc ggaacattga cccgatggat       660
     agcgcggtta taacaatcgg acgcattcac ggcggagaaa tccaaaatgt tattgcagaa       720
     actgcctttt tggatggaac gattaggacg ctttctccag aaacaatgga aatcgtttgg       780
     actcgtttaa aacaattagc aaaaggatgg gaagaagcct accaatgtga agtagaattc       840
     catcctggat ccgattacta tcaagtggac aatgatccag ttgaaacaga agaattcatc       900
     cactttttgg aagaacaata tccagaaagc tatgtgccag ctcgttcagc gatgactgga       960
     gaagattttg gttacttttt atctgaaatt aaagggttta tgttttggtt aggcgtggat      1020
     tccgagtaca gtttgcatca cgcgaaactt agtccaaaag aagaagctat tccatttgca      1080
     atagatgtat tagtgaactt tttggaaagc aaataa                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page