(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1012

AL596167.LIN1012     Location/Qualifiers
FT   CDS_pept        complement(69220..70065)
FT                   /transl_table=11
FT                   /gene="lin1012"
FT                   /note="similar to conserved hypothetical proteins like to
FT                   B. subtilis YkuT protein"
FT                   /db_xref="GOA:Q92D09"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D09"
FT                   /protein_id="CAC96243.1"
FT                   /translation="MNLLKKWFSSIDWDQFWNHIISVGIKIAILIALYFIFRVVGNKII
FT                   RSFFRKYRQQQAVSVGRADTLESLISNFYGYVLFFTFAILLLQNFMDVTAIIASAGVAS
FT                   LAIAFGAQGLVSDVVTGFFILLERQLDVGDTITIGLVNGTVEALGLRTTQVRDFDGTLH
FT                   FIPNRQIMVVSNHSRGNMRVMVDIQISPHEDPEKAIKIIGEVCDVAAKENKNIVEPPVV
FT                   LGVQNIDATNMIIRVVGKAVNGEQYSVQRDLLKDIREALAENEIELPLNFVSTFGPNNN
FT                   "
     atgaatttac tcaaaaagtg gttcagttct attgactggg accaattttg gaatcatatt        60
     atttcagttg gaataaaaat tgccatttta attgctcttt attttatttt ccgcgtggtt       120
     ggtaataaaa ttatccgtag tttcttccgc aaatatcggc aacaacaagc agtttctgtt       180
     gggcgcgcgg atacgttaga aagcttaatt tctaattttt acggctatgt tttattcttc       240
     acttttgcga ttttattatt acagaacttt atggatgtta cagcgattat tgcaagtgct       300
     ggggtggcga gtttggccat tgcctttggt gctcaagggc ttgttagtga cgttgtgact       360
     ggatttttta ttctacttga acgtcaactt gatgttggtg atacgattac cattggacta       420
     gttaatggaa cagtagaagc acttggcctt agaacaacac aggtacgtga ttttgatggc       480
     acgcttcatt tcattcctaa cagacaaatt atggtcgtta gtaatcattc gcgcggtaat       540
     atgcgtgtga tggtggacat tcaaattagt ccacatgaag atccggaaaa agcaattaaa       600
     attattggtg aggtttgtga cgttgctgca aaagaaaata aaaatatcgt tgagccccct       660
     gttgtcttag gcgtgcaaaa cattgacgca acaaatatga ttatccgcgt agttggtaaa       720
     gcagtgaacg gcgagcagta ttctgttcaa cgtgacttac tcaaagatat tcgcgaagca       780
     ctcgcagaaa acgaaattga attaccactt aattttgtta gcacattcgg accaaataat       840
     aattaa                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page