(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1016

AL596167.LIN1016     Location/Qualifiers
FT   CDS_pept        73501..73992
FT                   /transl_table=11
FT                   /gene="lin1016"
FT                   /note="similar to phosphotransferase system
FT                   glucose-specific enzyme IIA "
FT                   /db_xref="GOA:Q92D05"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D05"
FT                   /protein_id="CAC96247.1"
FT                   /translation="MFKKFLKKSKNETVFAHVTGQLIALEDVPDPVFNQKMMGEGIAIK
FT                   PESGTIVAPVDGKIIQLAETKHAFGIRTDMGQEILVHIGLETVSLNGEGFNVLVNVGDK
FT                   VKVGDPIVEADFDFIKKNAASTVVPMVVTNSSEGKYDFEFAGTPNTVAGKTEVFTTNLI
FT                   "
     atgtttaaaa aattcttgaa aaaaagtaaa aatgaaaccg tatttgctca tgtgactgga        60
     caactgattg cgttagaaga tgttccagat ccagttttta atcaaaagat gatgggcgaa       120
     ggtattgcaa ttaaaccaga aagcggcaca atcgtagcgc cagttgatgg gaaaattatt       180
     caacttgcag aaacgaaaca tgcttttggt attcgcacgg atatggggca ggaaattctc       240
     gtgcatatcg gtttagaaac ggtatcatta aacggagaag gttttaacgt gttagtaaac       300
     gttggcgata aagtaaaagt aggcgatcca atcgttgaag cggactttga ttttatcaag       360
     aaaaatgccg caagcacagt ggtaccaatg gttgtaacta atagttcaga aggcaaatac       420
     gattttgaat tcgctggaac tccaaatacg gttgctggga aaacagaagt atttactaca       480
     aatttaatat aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page