(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1017

AL596167.LIN1017     Location/Qualifiers
FT   CDS_pept        74105..74800
FT                   /transl_table=11
FT                   /gene="lin1017"
FT                   /note="similar to E. coli copper homeostasis protein CutC"
FT                   /db_xref="GOA:Q92D04"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D04"
FT                   /protein_id="CAC96248.1"
FT                   /translation="MLEVIVQNPRDAYLAEKYGANRMEVVSAISEGGLTPSYGAIKEIV
FT                   RASKLPAMMMIRPHSFSFVYDEPARIVMERDIELAKEVGVKGIVYGGITEDGNIDQELL
FT                   EKVIEWKGDLDLTFHRALEATKDIEASYQVLRTYGQDINQLLTSGGTASALDSLPRLKR
FT                   WINDSKENPSSFKILVGSGVKPENIAIFQETLNHTDYHVGSAARETNDFAKDILKEKIN
FT                   ILKQHINQD"
     atgttagaag tgatagttca aaacccaaga gatgcgtact tagcagaaaa atatggcgca        60
     aatagaatgg aagtagtttc cgctataagt gaaggtggcc taacgcctag ctacggtgct       120
     attaaagaaa tcgttcgtgc ttcaaaactt ccggcgatga tgatgattcg ccctcatagt       180
     ttttcgtttg tatacgatga gcctgctaga attgtgatgg aacgagatat tgaacttgca       240
     aaagaagttg gggtcaaagg tatcgtttat ggtggaataa cggaagacgg aaacatcgat       300
     caagagcttc tagaaaaagt gattgagtgg aaaggtgact tagaccttac tttccatcgt       360
     gcgctagaag caacaaaaga tattgaagca agctaccaag ttttacgtac atacggccaa       420
     gacattaatc aattattaac ttcaggtgga acagctagtg cacttgattc tttgccacgc       480
     cttaaacggt ggataaatga cagtaaagaa aatccaagtt catttaaaat tctagttgga       540
     agtggcgtta aacctgaaaa tattgctatc tttcaagaaa cactaaatca tacagattat       600
     cacgtcggaa gtgcagctag agaaacgaat gatttcgcaa aagacatttt aaaagaaaag       660
     atcaatattt taaagcagca tattaaccaa gattga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page