(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1018

AL596167.LIN1018     Location/Qualifiers
FT   CDS_pept        74880..75752
FT                   /transl_table=11
FT                   /gene="lin1018"
FT                   /note="similar to B. subtilis YitL protein"
FT                   /db_xref="GOA:Q92D03"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D03"
FT                   /protein_id="CAC96249.1"
FT                   /translation="MNNYIGKSQVMTVKEIKETGWLLEKDEVTVFLSKSNTHETELAVG
FT                   DEVTAFIFVDYDREIRATTIIPKIQVGHYGWGTVTEVRKHLGVFVDIGIEKDVVVSLDD
FT                   LPALPHLWPKKEDRVMIALRVDEENRVWGVLAEEEQFRAIAVRADQDLFNQNVEGTIYR
FT                   LLKVGSFVFTDDFHIGFIHESERTAEPRMGERVKARVIAVKPDGSLNLSLRGRAHEVLN
FT                   DDAEMILTYLRSVGGEMPFGDKSDPDAIRAKFGISKAQFKRAIGTLLKARRITQENGVI
FT                   TKLTEEASD"
     atgaataact atattggcaa aagccaagta atgacagtaa aggaaattaa agaaacaggt        60
     tggctcctag agaaagatga agtgactgtt tttttatcta aatcgaatac acatgaaaca       120
     gaacttgctg ttggagatga agtaacagca tttatttttg ttgactacga ccgagaaatc       180
     cgcgcaacaa caattattcc aaaaattcaa gttggacatt acggctgggg cacagtaacc       240
     gaagtacgca aacatttagg tgtatttgtg gatattggta ttgaaaaaga tgtcgttgta       300
     tcattagatg atttgcctgc actaccacat ttatggccga aaaaagaaga ccgagtgatg       360
     attgcacttc gagtagacga agaaaatcgc gtgtggggag ttctcgctga agaagaacaa       420
     ttccgcgcta ttgcggttcg tgcagatcaa gaccttttta atcaaaatgt agaaggaacc       480
     atttatcgat tacttaaagt tggctccttt gtctttacag atgatttcca tattggcttt       540
     attcatgaaa gtgaacggac tgcagaaccg agaatgggag aacgtgtaaa agcccgtgtt       600
     attgcagtga aaccagatgg ctcacttaat ttatcattac gtggtagagc ccatgaagta       660
     ttaaatgacg atgcggaaat gatattaact tacttacgaa gtgttggcgg ggaaatgcca       720
     tttggagata aatcagatcc agatgcaatc cgtgctaaat tcggaattag taaggcacaa       780
     tttaaacgcg caattggtac acttttaaaa gcaagacgga ttacacaaga aaatggagta       840
     attactaagt taacagaaga ggcatccgac taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page