(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1019

AL596167.LIN1019     Location/Qualifiers
FT   CDS_pept        75888..76601
FT                   /transl_table=11
FT                   /gene="lin1019"
FT                   /note="similar to B. subtilis YvqF protein"
FT                   /db_xref="GOA:Q92D02"
FT                   /db_xref="InterPro:IPR016975"
FT                   /db_xref="InterPro:IPR024425"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D02"
FT                   /protein_id="CAC96250.1"
FT                   /translation="MKKMESSVVFIFLIAIIVGVGLEMLFQWELLILFALGIFFIFTSR
FT                   KASATKKSAKNSLFIGIVFIIIAVLLTTTFKVGLVVAGIYAIIHYISRKRAPQLLMLKT
FT                   REPDSKIDRTGKFIRNQWFGNQRILDVVYEWDDINIQTGIGDTILDLGNTVLPTGESII
FT                   MIRSVSGKIRILVPFDIGICIEHSAIFGNIQYDKESTSIQNNSIKVYSDNYESSARKVK
FT                   IMTSVIFGDLEVIRL"
     ttgaaaaaaa tggaaagctc ggttgttttt atatttttaa ttgcgattat tgttggcgtt        60
     ggtcttgaga tgttattcca gtgggaatta ctcattttat ttgcactcgg aatattcttc       120
     atttttacat caaggaaagc aagtgccacg aaaaagagcg caaaaaactc actatttatt       180
     ggtatcgtat ttatcattat tgcagtgctg ttaacaacta cttttaaagt tggacttgtt       240
     gttgcaggta tttatgcgat tattcattat ataagccgga agcgggcacc ccaattatta       300
     atgcttaaaa cgagagagcc agacagtaaa attgatcgca cgggtaaatt tattcgtaat       360
     cagtggtttg gtaatcagcg gatattagat gtcgtgtacg aatgggatga catcaatatt       420
     caaacaggaa taggcgatac gattcttgat ttaggaaata cggtgcttcc gactggcgaa       480
     agtattatta tgattcgcag tgtatccggg aaaattcgta tcctcgttcc atttgatatt       540
     ggcatttgta ttgaacactc cgcgattttc ggaaatatcc aatatgataa agaaagcacc       600
     tctatccaaa ataatagcat caaggtctac tcagataatt acgaaagttc cgcacgaaaa       660
     gtgaaaatca tgacttctgt aatcttcgga gatttagagg tgatcaggtt atga             714
//

If you have problems or comments...

PBIL Back to PBIL home page