(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1020

AL596167.LIN1020     Location/Qualifiers
FT   CDS_pept        76598..77656
FT                   /transl_table=11
FT                   /gene="lin1020"
FT                   /note="similar to two-component sensor histidine kinase in
FT                   particular B. subtilis YvqE protein"
FT                   /db_xref="GOA:Q92D01"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017202"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D01"
FT                   /protein_id="CAC96251.1"
FT                   /translation="MSFSKLMMVVCSGLLLVATAIGTVGYYFFSEGSWYKILIEQKIFY
FT                   IPFIVFVPLTAISIGLIIGGLLGYFVKQKFESIDFSIRLLGQGDLEKKITSEEDETFLE
FT                   VQQVYKQIDRLRDKMKAQTILTQKLASDRAESSGQTKEAILSEERHRIARELHDSVSQQ
FT                   LFAAMMLLSALNEQSEKSATPAMQKQLKMVESIVNESQSEMRALLLHLRPTQLEGKSLK
FT                   TGIEQLLKELTTKLPIEVEWQIEDINLQKGIEDHLFRIVQELLSNTLRHSKAKLLEVRL
FT                   VTMDNLAVMKVVDDGVGFDMDNVRQGSYGLQNMRERVAEFGGTIKIISFKGRGTSVEIK
FT                   IPLVAKKDVENE"
     atgagttttt cgaaactaat gatggtagtt tgctcaggat tactccttgt tgcaacagcc        60
     attggaacgg taggatacta ttttttcagt gaaggttctt ggtataaaat cttaattgaa       120
     caaaaaatat tttacattcc ttttatcgtc tttgttccgc tgacagctat ttcgataggt       180
     ttaattattg gcggcttact tggctatttt gttaagcaaa agtttgagtc gattgacttt       240
     tcgattcggc tgctaggaca aggcgattta gaaaaaaaga ttactagtga agaagatgaa       300
     acttttttag aagtacagca agtctataag caaatcgacc gtttgcgtga taagatgaaa       360
     gcacaaacga ttctgactca aaagctagca agtgatcgcg ctgaatcaag tggtcaaacg       420
     aaagaagcta ttttgtcaga agagcgtcac cggattgcgc gtgagttaca tgattctgtg       480
     agtcaacaat tattcgcagc gatgatgcta ttatctgcct taaatgagca aagcgaaaaa       540
     agtgcaactc ccgccatgca aaagcaacta aaaatggtag aatctattgt caatgaatcc       600
     caatctgaga tgcgtgcact attacttcat ttgcgaccaa cgcagctcga aggaaagtca       660
     ttaaaaacgg gtatagaaca attattaaaa gaattaacaa ccaaattacc catcgaagtc       720
     gaatggcaaa ttgaagatat taatttgcaa aaaggtattg aagatcattt attccggata       780
     gtgcaagaat tactatcgaa tactttgcgt cactctaaag caaaattatt agaagtacgg       840
     ttagtgacga tggataattt agccgtaatg aaagtagttg atgacggcgt aggattcgat       900
     atggataatg ttcgtcaagg ttcttacggt ttacaaaata tgcgtgaacg agtcgctgaa       960
     tttggtggta ccattaaaat aattagcttt aaaggacgag gaactagcgt agaaataaaa      1020
     atcccacttg ttgcgaaaaa ggacgtggaa aacgaatga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page