(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1021

AL596167.LIN1021     Location/Qualifiers
FT   CDS_pept        77653..78291
FT                   /transl_table=11
FT                   /gene="lin1021"
FT                   /note="similar to two-component response regulator, in
FT                   particular B. subtilis YvqC protein"
FT                   /db_xref="GOA:Q92D00"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:Q92D00"
FT                   /protein_id="CAC96252.1"
FT                   /translation="MIKVLLVDDHEMVRIGVSAYLSVQDDMEVVGEAENGREGADMALE
FT                   LRPDIILMDLVMDEMDGIEATKEIMKNWKEAKIIIVTSFIDDEKVYPALEAGASSYMLK
FT                   TSTASEIADAIRATYGGDSVLEPEVTGKMMQRLTAKPEKNLHDDLTNRENEILLLIAEG
FT                   KSNQEIADELFITLKTVKTHVSNILSKLDVQDRTQAAIYAFKHDLVEKK"
     atgataaaag ttttactagt agatgatcat gaaatggtac gtataggcgt gtcagcttat        60
     ctttctgttc aagatgacat ggaagtagtc ggcgaggcag aaaacggccg agaaggcgct       120
     gatatggctt tagagttgcg tccagatatt atcttaatgg atttagttat ggatgagatg       180
     gatggcattg aagcaacgaa agaaattatg aagaattgga aagaagcaaa aattattatc       240
     gtcaccagtt ttattgacga tgaaaaagta tatccggcac tcgaagctgg agcgagcagt       300
     tatatgttaa aaacctcgac agcgagtgaa attgccgatg cgattcgagc tacatacggc       360
     ggtgactctg tccttgaacc agaagtaact ggtaaaatga tgcaaagact aaccgctaaa       420
     ccagaaaaaa acctacatga tgatttaacg aatcgcgaaa atgaaatctt acttcttatt       480
     gcagaaggta aatcgaatca agaaatcgcg gatgaactat tcattacttt aaaaacagta       540
     aaaacacatg taagtaatat tttatccaaa ttagatgtac aagaccgcac acaagctgca       600
     atctatgcat ttaaacatga tttagtagaa aaaaagtaa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page