(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1025

AL596167.LIN1025     Location/Qualifiers
FT   CDS_pept        complement(80926..81891)
FT                   /transl_table=11
FT                   /gene="lin1025"
FT                   /note="similar to B. subtilis LytR protein"
FT                   /db_xref="GOA:Q92CZ6"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="PDB:3OWQ"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ6"
FT                   /protein_id="CAC96256.1"
FT                   /translation="MTETRTETKQKKPSTFTKVMKIASVTLLGILFFSITGLAAKYYIT
FT                   VQNTFTKINVPLETSNKTTSDLEKKKPFSVLLMGSDARPGETNGRADTIILATANKQQN
FT                   AVEMVSIPRDTKVDYGNGDIGKINASYSNGGPSGTVSAVEKLMPGVPVDYFISINMEGF
FT                   KDLVDAVGGITVYNDIDLTEVNSKFVKGNITLNGTDALQYVRIRHEDPRGDFGRQDRQR
FT                   DVIIGIANKVISSSGVSNFESIMKAVGDNFQTNMTLTDITSMATNYSSVLKNVDSQELK
FT                   GEGEMIYSESYGFDLYYFAPDETDLERVINMFKKSLDITE"
     atgacagaaa ctaggacaga aacgaagcaa aaaaaaccgt ccacttttac taaagttatg        60
     aaaattgcta gcgttacact tttaggaatt ctctttttct ccattacagg tttggcagcg       120
     aagtattaca tcaccgttca aaatactttt acaaaaataa atgtcccttt agaaacaagt       180
     aataaaacaa caagtgattt agaaaagaaa aaaccttttt ccgtattact tatgggttct       240
     gatgctcgcc ccggtgaaac gaatggtcga gcagatacaa ttatccttgc aacagccaat       300
     aaacaacaaa acgctgtcga aatggtcagc atccctcgtg atacaaaagt agattatgga       360
     aatggcgata ttggaaaaat caatgcttcc tattcgaacg gaggcccttc aggaaccgtt       420
     tcagcagttg aaaaactaat gccaggtgtt ccggtagatt attttatttc tatcaatatg       480
     gaaggcttta aagaccttgt tgacgcagtt ggtggtatta cagtttataa cgacattgat       540
     ttaacagaag taaatagcaa atttgtaaaa ggaaatatta ctttaaatgg gacggacgct       600
     ttacaatatg tccgtattcg tcacgaagat cctcgcggtg actttggtcg tcaagataga       660
     caacgcgacg ttattatcgg tatcgcgaat aaagttataa gttcatcagg cgtatccaat       720
     ttcgaaagca taatgaaagc tgttggagat aatttccaaa ctaatatgac gcttacagat       780
     attacttcta tggctaccaa ttattcttcc gttcttaaaa acgttgattc gcaagagctt       840
     aaaggtgaag gagaaatgat ttatagtgag tcatacggat tcgatttata ttattttgca       900
     ccagatgaaa ccgacttaga acgtgtaatt aacatgttta agaagagttt agatataact       960
     gaataa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page