(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1029

AL596167.LIN1029     Location/Qualifiers
FT   CDS_pept        complement(85165..85968)
FT                   /transl_table=11
FT                   /gene="lin1029"
FT                   /note="highly similar to B. subtilis YoaT protein"
FT                   /db_xref="GOA:Q92CZ2"
FT                   /db_xref="InterPro:IPR008535"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ2"
FT                   /protein_id="CAC96260.1"
FT                   /translation="MKFFRLLWVFTWKQALCCLFPGIIFISLALTKLIEIPFIARYDLL
FT                   LIICLVTQIFLIKFGLETWDELKVIMIFHLIGLGLEIYKVHMGSWSYPEPGLMKLFGVP
FT                   LYSGFMYSSVASYICQAWKRFDLNMTNWPNIWLVSSLCIAIYANFFTHHFIMDFRWILI
FT                   ILVLLLFRKTYVYFKVSATQLKMPLSFSFLCIAFFIYLAENIASFYGAWAYPDQLVAWR
FT                   PVHVSKITSWYLLVIISIIIVAQLKFIKQKWEQDQITTKSEATLK"
     atgaaatttt ttcgcttact gtgggtattt acttggaaac aagcactttg ttgtcttttt        60
     ccgggcatta ttttcatttc actcgccctt acaaaactaa ttgaaattcc ttttattgcg       120
     cgctatgact tacttttaat catttgcctc gtgacacaaa ttttcctgat aaagtttggg       180
     ttagaaactt gggatgaact taaagttatc atgatttttc acttgattgg tctggggctt       240
     gaaatttata aagtacatat gggatcttgg agttatccag aacccggttt aatgaaactc       300
     ttcggcgtac cactgtatag cggatttatg tattcaagcg tggcaagtta tatttgtcag       360
     gcctggaaga ggtttgatct taacatgacc aattggccaa atatttggtt agtaagtagt       420
     ctttgcatag cgatttacgc gaattttttc acgcaccatt ttattatgga ttttcggtgg       480
     attttgatta ttttagttct cctactattc cgaaaaacat atgtttattt taaagttagc       540
     gctactcagc tcaaaatgcc tttatctttt tcatttttat gtattgcatt ttttatctat       600
     ctcgcggaaa atattgctag tttttacggt gcttgggcgt atcctgatca gcttgttgct       660
     tggcggccag tgcatgtctc aaaaataacg agttggtact tacttgtgat tattagtatt       720
     attatcgtcg cgcaacttaa attcattaaa cagaaatggg aacaggacca aataacaaca       780
     aaaagcgagg ctacactgaa atag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page