(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1030

AL596167.LIN1030     Location/Qualifiers
FT   CDS_pept        complement(86035..86616)
FT                   /transl_table=11
FT                   /gene="lin1030"
FT                   /note="weakly similar to molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A"
FT                   /db_xref="GOA:Q92CZ1"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ1"
FT                   /protein_id="CAC96261.1"
FT                   /translation="MKNAKVNVGIVLAGGKSSRFGKSKALFQNEATGKTWVELTVNKLK
FT                   PFCEMVFVSANQENYQKLIALFHEDSAIQIIPDQPAYKDFGPLGGIYAVMVQKNAYPEA
FT                   NYLILPVDMPFLTSSEISRLAAFPNHFAKTAEENHYLVLNIPYSREILHNLLQKEQHRV
FT                   RGLLEKLQTKPLEFENEAPFTNINRQNELF"
     ttgaaaaacg caaaagttaa tgtgggtatt gtattagctg gtgggaagtc tagccgtttt        60
     ggcaagtcaa aagccctttt ccagaatgag gcgactggga aaacatgggt ggagctcact       120
     gttaataagt tgaagccatt ttgcgaaatg gttttcgtat ccgcaaatca agaaaattat       180
     caaaaactaa ttgcgctttt tcatgaggac tcagctattc aaattattcc cgaccaacca       240
     gcatataaag atttcgggcc gcttggtgga atttacgctg tcatggttca aaaaaatgct       300
     taccccgaag ctaactacct gatacttcct gtcgatatgc cttttttaac ttccagcgaa       360
     attagtcgat tagctgcatt tccaaatcac tttgcaaaaa cagcagagga aaatcactat       420
     ttggttttga acattcccta ctcgcgtgaa atcttacata atttattgca aaaagaacaa       480
     catcgtgttc gcggcttact tgaaaaacta caaactaagc cgttagaatt tgaaaatgaa       540
     gcaccattta cgaatatcaa ccgccaaaat gaactttttt aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page