(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1031

AL596167.LIN1031     Location/Qualifiers
FT   CDS_pept        complement(86597..87259)
FT                   /transl_table=11
FT                   /gene="lin1031"
FT                   /note="similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q92CZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CZ0"
FT                   /protein_id="CAC96262.1"
FT                   /translation="MLRLQFHKKLPFHDLNIDYTFEKPVTAMMGASGSGKSTLFQCVSG
FT                   LKSIDGGIIEFDGTPWDDSNISLHLPVTERKVGYLFQNLALFPNMNVYENIAFGLKVKK
FT                   KKKKEQAEIQQQVRKMSDYLQISHLLYSSVQKLSGGEKQRVAMARAMITEPKLLLLDEP
FT                   FNGLDEETRLICMKLVGQMAKDFHIPVIFVTHYASEAEMMTEEILVMRDGRLEKRKS"
     atgctgagat tacaatttca taaaaaactt ccttttcatg atttaaatat tgattatacg        60
     tttgaaaaac cagtaactgc gatgatgggt gcaagtggtt ctggaaaatc aacgttattc       120
     caatgtgtga gtggattaaa gagcatcgac ggcgggatta tcgagtttga tgggacaccg       180
     tgggatgatt cgaatatttc cttacacctt ccagtaactg aacgaaaagt cggttactta       240
     ttccaaaatc tagctttatt tccaaatatg aatgtttatg aaaatatcgc gtttggctta       300
     aaagtgaaaa aaaagaagaa aaaagaacag gcagaaatcc agcagcaagt aagaaaaatg       360
     agtgattatc tgcaaatttc gcacctacta tattcttctg ttcaaaaact ttctggcggt       420
     gagaaacaac gggttgcgat ggcacgagcg atgattactg agccgaaatt actgttactt       480
     gatgaacctt tcaatgggct agatgaagaa acacgtttaa tttgtatgaa attagttggt       540
     cagatggcca aagatttcca tataccagtt atttttgtaa cgcattatgc ctcggaagca       600
     gaaatgatga cggaagaaat tttagttatg agagatggtc gacttgaaaa acgcaaaagt       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page