(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1033

AL596167.LIN1033     Location/Qualifiers
FT   CDS_pept        88041..88814
FT                   /transl_table=11
FT                   /gene="lin1033"
FT                   /note="similar to molybdate ABC transporter binding
FT                   protein"
FT                   /db_xref="GOA:Q92CY8"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="InterPro:IPR041879"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY8"
FT                   /protein_id="CAC96264.1"
FT                   /translation="MKKIAILISCLLVLLVGACANTSEKAKTTTTIHISAAASLKDTMD
FT                   DVKPLFEKAYPSIKLSFDFGGSGQIRERVESGAPIDGVLLASKKDADTLSNQKLAENTK
FT                   EFAGNDLVLIEPKNADQKEGLSLEQLLDNADKIAIGDPESVPAGAYAKQTLGNLNLYNT
FT                   EKAKLVLATDVRQVLSYVEAGNADAGFVYQTDAILSKKVQVKAKIDAKLHDPIAYYSAQ
FT                   VTDSEKKEPTTTFLDFMNKSEAQKILEKYGFKAAD"
     atgaaaaaaa tagcgatact tataagctgc ttattagtac tacttgtagg tgcatgcgcg        60
     aatacttcag agaaagcaaa aacaacaaca actatacata tttcagcagc agcaagctta       120
     aaagatacga tggatgacgt aaaaccactt ttcgaaaaag catatccatc tattaaatta       180
     tcttttgact ttggtggttc tgggcaaatt cgtgaacgcg tggaaagtgg tgcgccaatt       240
     gatggtgtcc ttttagcaag taaaaaagat gcagatacat taagtaatca aaaattagcc       300
     gaaaacacga aagaatttgc cgggaatgac cttgtgttaa ttgaaccgaa aaatgctgat       360
     cagaaggaag gattaagttt agaacaatta ctggataatg ccgataaaat tgccattgga       420
     gatccggaat ctgtcccagc aggcgcttat gccaagcaaa ctcttggaaa tttaaatctt       480
     tataatacag aaaaagcaaa actcgttctt gcgacagatg ttcgccaagt tttatcatat       540
     gtcgaagcgg gaaatgcaga tgcaggcttc gtttaccaaa cggatgcgat tttaagtaaa       600
     aaagtacaag tgaaagcgaa aattgatgca aaacttcatg acccaattgc ctactatagc       660
     gcacaagtaa ctgattcaga gaaaaaagaa cctaccacaa cattcctcga ctttatgaat       720
     aaatcagaag cacaaaaaat acttgaaaaa tacggattta aagcagcgga ttaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page