(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1034

AL596167.LIN1034     Location/Qualifiers
FT   CDS_pept        88909..90132
FT                   /transl_table=11
FT                   /gene="lin1034"
FT                   /note="similar to molybdopterin biosynthesis protein moeA"
FT                   /db_xref="GOA:Q92CY7"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY7"
FT                   /protein_id="CAC96265.1"
FT                   /translation="MIEKRNTIRMEQAREVLCNQITHLPVERKNVTEALNQVLQEPIFA
FT                   PFPAPYFRRSGYDGFAITEEDDGNYPITLHVVAEVPCGKTYDKPLKPGETVRIMTGAKV
FT                   PDNASKIIMLEQSREAENKNDIVLINTQKSSNITEIGAEFAKGDLLLDRGHTLNAGSIS
FT                   LLSSFGISEVQVIRKPKVAILSTGSELVPAGNSLPDGKIYNSNQPLLENLLTVHHAEIC
FT                   AAEQLPDNYEDTKARLLELTKIADLIVTTGGVSVGDYDFMADIAKQEAELLFNKIQMRP
FT                   GSPTTGMWLNKTLIIALSGNPGACFTGFYLLVEPVLATFMGKDNTATTKVRAKMASDYT
FT                   KNNGFDRFLRGTYHLSEEGEYLVELVGSDMSSALGNLHLTTCLFKIPGGKVGKYQGEEV
FT                   EAWLLSSK"
     atgattgaaa aaagaaacac cataagaatg gagcaagcga gagaagtatt atgtaaccaa        60
     ataacgcatc ttccagtcga acgaaaaaac gtcacggaag cgttaaatca agttttacaa       120
     gaaccgattt ttgcaccgtt tcccgcgccg tattttagac gttctggtta tgatgggttt       180
     gcaattacag aagaagatga cggtaattat ccgattactt tacatgtcgt agcagaggtt       240
     ccttgtggta aaacatatga taaaccacta aaacccggcg aaacagtgag gatcatgaca       300
     ggagcaaaag tacctgataa cgcctcaaaa attattatgc tcgaacaatc aagagaagct       360
     gaaaataaaa atgatattgt tcttataaat acgcaaaaat ctagtaatat tacggaaatc       420
     ggtgccgaat ttgcgaaagg tgatttgctc ttagaccgcg gtcacactct aaatgcaggc       480
     tcgataagtt tactatcatc attcggtatt tcggaagtcc aagtaattag aaagccaaaa       540
     gttgctattt tatctacagg aagtgaactt gtacctgctg gaaattcgct cccagatggc       600
     aaaatttata atagtaatca accactactt gaaaatcttc taacagtgca ccatgcagaa       660
     atctgcgcgg ctgaacaact accagataac tatgaagata caaaagcccg tttacttgag       720
     ctgacgaaaa ttgcggactt aattgtcact actggtggcg tttctgttgg agattatgat       780
     tttatggcgg atattgcaaa acaagaggca gaattacttt ttaataaaat ccaaatgaga       840
     cctggtagtc cgacaactgg aatgtggttg aataagacac ttattatcgc gctttcgggt       900
     aaccctggtg catgtttcac aggtttttat ttattagtag aacccgtact cgcaaccttt       960
     atgggaaaag ataatacggc aactactaaa gtccgagcaa aaatggcgag tgattacacg      1020
     aagaataatg gctttgaccg atttttacga ggaacctatc atctatcaga agaaggagag      1080
     tatttggttg aattggtagg aagtgatatg tcgagtgcgc taggaaacct tcatttaaca      1140
     acctgtttat ttaaaattcc aggcggtaag gttggaaaat atcaaggaga agaggtcgaa      1200
     gcatggctac tatcctccaa ataa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page