(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1036

AL596167.LIN1036     Location/Qualifiers
FT   CDS_pept        90593..91015
FT                   /transl_table=11
FT                   /gene="lin1036"
FT                   /note="similar to molybdopterin converting factor, subunit
FT                   2"
FT                   /db_xref="GOA:Q92CY5"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY5"
FT                   /protein_id="CAC96267.1"
FT                   /translation="MKYVALQHEKIEIGPLSEKLINKNHGGINLFVGTIREWTGDIQTE
FT                   EIRYTAYEAMALKELNKLATEVETKWGADVVIVHRLGLLEITDIAVFIGVSTPHRAACY
FT                   EGSRYIIERLKERVPIWKEEKDVDQIRWGGIDAHNG"
     atgaaatatg tagctttaca acacgaaaaa attgaaatcg gaccactttc tgaaaaacta        60
     atcaataaaa atcacggcgg aattaatctg tttgtcggca caattcgcga atggactggc       120
     gatattcaaa cagaagaaat tcgctacact gcttatgaag caatggcgtt aaaagagtta       180
     aataaattag ccacagaagt agaaactaag tggggtgcag atgtagtcat cgtccaccga       240
     ttaggacttt tagaaataac tgatatagca gtgtttatcg gcgtatcaac accacaccgg       300
     gctgcttgtt atgaaggatc cagatatatt attgaacgtt taaaagaacg agtaccaata       360
     tggaaagaag aaaaagatgt cgatcaaata aggtggggtg gcatagatgc tcacaacggt       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page