(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1038

AL596167.LIN1038     Location/Qualifiers
FT   CDS_pept        91260..91742
FT                   /transl_table=11
FT                   /gene="lin1038"
FT                   /note="similar to molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="GOA:Q92CY3"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CY3"
FT                   /protein_id="CAC96269.1"
FT                   /translation="MDKDDLTHFNDEKRAKMVDVTSKSETKRRAIARATIHMNEETLAR
FT                   IHAGKIAKGDVLAVAQVAGIMAAKKTSELIPMCHPIMTTKADISFDDDGKTALTITSEV
FT                   VTVGKTGVEMEALTAVTIAALTIYDMCKAMDKGMQIEKTYLVEKTGGKSGTFKAEA"
     atggataaag acgatttaac ccattttaat gatgaaaaac gtgcgaaaat ggtcgatgtc        60
     acgagcaaat cagaaacgaa acgacgtgca atcgctagag ctaccataca tatgaacgaa       120
     gaaaccttag cgcgtattca tgctggtaaa attgctaaag gagacgtttt ggctgttgca       180
     caagtggctg gcatcatggc cgcgaaaaaa acgagcgaac ttatcccgat gtgtcatcca       240
     atcatgacaa ccaaagccga tatttctttt gatgatgatg gaaagacggc attaacgatc       300
     acatcagaag tagtgactgt tggaaaaaca ggggtagaaa tggaagcact gacagcagtt       360
     accattgcag ctttaacaat ttatgatatg tgtaaagcaa tggataaagg aatgcaaata       420
     gaaaaaacat atttagtcga aaaaacaggt ggaaaaagcg ggacatttaa agcagaagcg       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page