(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1039

AL596167.LIN1039     Location/Qualifiers
FT   CDS_pept        91771..92772
FT                   /transl_table=11
FT                   /gene="lin1039"
FT                   /note="similar to molybdenum cofactor biosynthesis protein
FT                   A"
FT                   /db_xref="GOA:Q92CY2"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CY2"
FT                   /protein_id="CAC96270.1"
FT                   /translation="MQLLKDKFGRVHDYIRISVTDRCNLRCVYCMPEEGLTFLPHEKVL
FT                   SKDEIVSFMELMVKFGIKKVRITGGEPLLRTDIVEIVRGLGAIPEIEDISITTNAMYLA
FT                   KKAEALKEAGLTRVNISLDSLHADRFQAITRGGRLQKVLDGIQKAEEVGLFPIKLNVVL
FT                   IKGQNDDEITDFLQFTKDKDINIRFIEYMPIGHAGTSWKEKYLPLDTIFKACDDASFEY
FT                   EPVDSIRGNGPSENFRIKGAKGTFGVIHPVSAHFCDSCNRLRLTADGYIKACLYWDEEM
FT                   NIRPFIHEPVKLMQLVQKAIDNKPENHEMALKLQDEVQSNKPTWRRMSQIGG"
     atgcaattat taaaggataa atttgggcgg gtacacgatt acattaggat ttcagtaaca        60
     gatcgatgca atttaaggtg tgtgtattgt atgcccgaag aaggcctgac atttttgcct       120
     catgaaaaag tactatccaa agatgaaatt gtcagtttta tggagttaat ggtgaaattt       180
     ggcatcaaaa aagttcgcat cacgggtgga gaaccattac ttagaaccga tattgtggaa       240
     attgttcgtg gacttggagc aattcctgag atagaagata tttcgattac aacgaatgcg       300
     atgtatttgg caaaaaaagc agaggccttg aaagaagccg gattaacacg tgttaatatt       360
     agtttggatt ccttgcatgc agaccgtttc caagcaatta cacgtggagg ccgtttgcaa       420
     aaagtactcg atggtattca aaaagcggaa gaagttgggc tattcccaat taaactaaat       480
     gttgttttaa tcaaagggca aaacgacgat gaaataacgg atttccttca atttacaaaa       540
     gataaagaca ttaatattcg ctttattgaa tatatgccga ttggtcatgc gggtacgagt       600
     tggaaagaaa agtacttacc tctagatact atttttaaag cgtgtgatga tgctagtttc       660
     gaatatgagc cagttgattc gattcgcgga aatggtcctt ctgaaaactt ccggattaaa       720
     ggagcgaaag gaacatttgg tgtaatacat ccagttagtg cgcatttttg tgatagctgt       780
     aaccgattgc gactcacggc tgatggctat attaaagcat gtttatactg ggatgaggaa       840
     atgaatattc gtccatttat acatgaacca gtaaaattaa tgcaacttgt tcaaaaagca       900
     attgataata aaccagaaaa tcatgaaatg gcattgaaat tacaagatga agttcaatct       960
     aataaaccaa cttggcgacg tatgagccaa attggtggat aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page