(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1040

AL596167.LIN1040     Location/Qualifiers
FT   CDS_pept        complement(92805..93293)
FT                   /transl_table=11
FT                   /gene="lin1040"
FT                   /note="similar to molybdenum cofactor biosynthesis protein
FT                   B"
FT                   /db_xref="GOA:Q92CY1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY1"
FT                   /protein_id="CAC96271.1"
FT                   /translation="MEQKTFIKVTCSILTISDTRNLETDTSGKLIQSLLEAAGHQVITR
FT                   VIVPDDAPRIKQEMDKLAANGSFCLITNGGTGIAKRDVTYEALFATIQQEIPGFGEIFR
FT                   MLSYEEVGSRAMVSRAFAGFSKSGLLIFALPGSSNASRLATEKLIIPELPHLIAERQK"
     atggagcaaa aaacgtttat taaggtaact tgtagtattt tgacgattag tgatacaagg        60
     aatttagaaa ccgatacgag cggcaaactg attcaatctt tgttagaggc tgcgggacac       120
     caagtgatta cacgagttat tgttcctgac gacgcccctc gtataaaaca ggaaatggac       180
     aaattagcag ctaacggttc cttttgttta attacaaatg gcggtactgg aattgctaag       240
     cgcgatgtta cttatgaagc tttattcgca actattcagc aagaaattcc tggttttgga       300
     gaaatttttc ggatgcttag ttacgaggaa gttggtagcc gcgcgatggt atctcgtgct       360
     tttgcaggtt tttcgaagag cggtttgctg atttttgcct taccggggtc aagtaatgct       420
     tcgagactcg ctacggaaaa attaattata cctgaattgc cgcatttaat agcggaacga       480
     caaaaataa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page