(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1041

AL596167.LIN1041     Location/Qualifiers
FT   CDS_pept        complement(93305..94303)
FT                   /transl_table=11
FT                   /gene="lin1041"
FT                   /note="similar to molybdopterin biosynthesis protein MoeB"
FT                   /db_xref="GOA:Q92CY0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CY0"
FT                   /protein_id="CAC96272.1"
FT                   /translation="MERYDRQMRVANIGEIGQEKLLSKTILIVGVGAIGSYAAEICARM
FT                   GFGKLILIDRDYVELSNLQRQSLYTEQDALEKQAKAYAAQKAILLINSEIEVEYIVDDA
FT                   NMTSLTPFAKKIDYILDCTDNFMTRDFLNQFCFIHQIPWIFTSCAGNYANLMPITPPDS
FT                   ACLHCLLGDIPQTNAASCDIIGVDGALIPMVAGMQVSLLTQMILNPDFTANTYYQIDNW
FT                   QLNFQSLAVKKRPHCTGCSPEKVLSEVPFSEQTIALCGRDTVQFHLQNKSNYREIKQRL
FT                   AEQKMLYTENPALLSFNYEKYQFVIFKNGRVLLHGTENLAEAKKIYQLFFN"
     ttggaacgtt atgatagaca aatgcgagtc gcaaatatag gtgaaatcgg tcaagagaaa        60
     ttgctttcga aaacgattct gattgttggt gttggggcaa ttggttccta cgcggctgag       120
     atttgtgcgc gcatgggttt tgggaaattg attttaattg accgcgatta tgtggaatta       180
     agtaatttac aacgacaatc actttatacg gaacaagatg cgctcgagaa acaagcaaaa       240
     gcgtatgcag ctcagaaagc aatattgtta attaatagcg agattgaagt ggaatatatt       300
     gttgacgatg cgaatatgac aagtttaacc ccttttgcta agaaaattga ttacatactt       360
     gattgtacgg ataattttat gactcgcgat tttttaaacc aattttgttt tatccatcaa       420
     attccttgga tttttacttc ttgtgcggga aattatgcta atcttatgcc gattacccct       480
     cctgattctg cttgtttaca ctgtttgctt ggtgatattc cccaaacaaa tgctgcaagt       540
     tgcgatatta ttggagttga tggcgcgctc attccgatgg tcgcgggaat gcaagtttcg       600
     ttacttacac aaatgatttt aaaccctgat ttcactgcaa atacatacta tcaaatagat       660
     aattggcagt tgaatttcca atcactagct gtcaaaaaac gccctcactg cacaggctgc       720
     tcacctgaaa aagtactttc agaagttccc ttttctgagc aaactatcgc actttgtgga       780
     cgagataccg tacagtttca cctccaaaat aaaagtaact accgcgaaat aaaacaacga       840
     ttagcggaac aaaaaatgct ttatacggaa aatccagctt tactaagttt taattatgaa       900
     aaatatcaat ttgttatttt taaaaatggt cgtgttttac tgcatggaac tgaaaattta       960
     gcggaagcaa agaaaatata ccaactattt tttaattaa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page