(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1042

AL596167.LIN1042     Location/Qualifiers
FT   CDS_pept        94440..94991
FT                   /transl_table=11
FT                   /gene="lin1042"
FT                   /note="similar to B. subtilis YdfE protein"
FT                   /db_xref="GOA:Q92CX9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX9"
FT                   /protein_id="CAC96273.1"
FT                   /translation="MKKKLDTTKFYPAYPVFLLTYLNELGEAQMSTGSSSYTLGDTLVI
FT                   GISAESNASNYLKPGEKFAVNFPTTKQFDLIEQGGFSSGKRIDKVKEYQIELTKSESGA
FT                   LYIDSCPIIFECTVGQTIRDADYHTVFAKIDTRLMEETLIDTAGNFVHDELDLVLFSGD
FT                   AYERKFRKLDIKIEKVGGHL"
     atgaaaaaga aactagacac aaccaaattt taccctgctt atccagtttt tctattaact        60
     tacttaaatg aactaggaga agcgcaaatg tcaacgggat catcatcgta tacacttgga       120
     gatactttag tcattggtat atctgccgaa agtaacgcga gcaactattt aaaaccggga       180
     gagaaattcg ccgtgaattt tccgaccact aaacagttcg atttaattga acaaggtggc       240
     ttttcatccg gaaagcgtat cgataaagta aaagaatacc agattgagct aaccaaaagt       300
     gaaagcggag cactatacat agattcatgc ccgattattt ttgaatgtac ggtaggtcaa       360
     acgattagag atgctgacta tcatactgtt tttgctaaaa ttgacacgcg tttaatggag       420
     gaaactttaa ttgatacagc tggtaatttc gtacatgatg aactagactt agttcttttt       480
     tcaggcgatg cttatgaacg taaatttcgc aagttagata taaaaataga aaaagttggc       540
     ggacatttat aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page