(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1043

AL596167.LIN1043     Location/Qualifiers
FT   CDS_pept        complement(95038..95589)
FT                   /transl_table=11
FT                   /gene="lin1043"
FT                   /note="similar to formylmethionine deformylase and to B.
FT                   subtilis YkrB protein"
FT                   /db_xref="GOA:Q92CX8"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CX8"
FT                   /protein_id="CAC96274.1"
FT                   /translation="MLTMDDIVREGHPALREVATEVTFPLSDEEKKLGHDMLEFLINSQ
FT                   DEELAEKYGLRGGVGIAAPQLAVTKRFLAIHVHDEKDRLYSYVLYNPKIRSHSVQQACL
FT                   SGGEGCLSVDREVPGYVVRSERVTIDAFDENGTPLKLRFKGYPAIVVQHEIDHLNGVMF
FT                   YDHINKENPSYLPPDVDVFG"
     atgcttacaa tggacgatat tgtacgagaa ggtcatccag cacttcgcga agttgcaaca        60
     gaagtgactt tcccgctttc agatgaagaa aaaaaattag ggcacgatat gctcgagttt       120
     ctaattaata gtcaggatga agagttagca gaaaaatacg gtttgcgtgg tggtgttgga       180
     attgcggctc cacaactagc tgtaacaaaa cgtttcctag ctatccatgt acacgatgaa       240
     aaagatcgtc tttatagtta tgtgctttat aatccaaaaa ttcgtagcca ttctgtacaa       300
     caagcttgtc tttctggtgg agaaggttgc ctttccgttg accgtgaagt tcctggttat       360
     gttgtacgta gtgaacgagt gacaattgat gcctttgatg aaaatggtac gccacttaag       420
     ctccgtttta aaggctatcc agcaattgtt gtgcaacatg aaattgatca tttgaatggc       480
     gttatgtttt atgaccatat taataaagaa aatccatctt acttgccacc tgatgtggat       540
     gtatttggat ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page