(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1050

AL596167.LIN1050     Location/Qualifiers
FT   CDS_pept        103248..103520
FT                   /transl_table=11
FT                   /gene="lin1050"
FT                   /note="similar to B. subtilis YktA protein"
FT                   /db_xref="InterPro:IPR007920"
FT                   /db_xref="InterPro:IPR023324"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67357"
FT                   /protein_id="CAC96281.1"
FT                   /translation="MEYSYPLNPDWTTEEMTIVVQFLEAIERAYEKGIDTLELKEKYRA
FT                   FKQVVPAKGEEKRIGIDFEKASGYSAYKVMQLVKNATTSKIKMQP"
     atggaatata gttatccact aaatccagac tggacaaccg aagaaatgac gattgttgta        60
     caatttttag aagctatcga acgagcatat gaaaaaggta ttgatacact tgaactcaaa       120
     gaaaaatacc gagcatttaa acaagtagta cctgcaaaag gagaagaaaa acggattggc       180
     atagactttg aaaaagcaag tggatattca gcctataaag tcatgcaact cgtaaaaaac       240
     gcaacaacaa gcaaaataaa aatgcaacca taa                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page