(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1053

AL596167.LIN1053     Location/Qualifiers
FT   CDS_pept        complement(105267..105881)
FT                   /transl_table=11
FT                   /gene="lin1053"
FT                   /note="similar to B. subtilis YktB protein"
FT                   /db_xref="InterPro:IPR009403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CW8"
FT                   /protein_id="CAC96284.1"
FT                   /translation="MTFKGFSKKDFKTMQIPGLDARMAGIQNDIQPKFKAVGEELTTYL
FT                   SAKLGDEMFLHIARHQRRSVNPPESTWLAICHDKRGYKKHPHFQVGLFDNYLFIWLAFI
FT                   YENEESTKIANRFLKEKKLLAELPDTFAISPDHTEEKTYPVHGGQLDATLKRFRDVKKG
FT                   EFLVGKIYLPDDNHLSPGKDFIKEAEMVLDELIPLYKAALQ"
     atgactttta aaggatttag taagaaagat tttaaaacaa tgcaaattcc tggtctggac        60
     gcacgtatgg ctggaattca aaatgatatt cagccgaaat ttaaagcagt tggggaagaa       120
     ttaactactt atttaagtgc caaacttggc gatgaaatgt ttttacatat tgctcgtcac       180
     caaagacgtt cggttaaccc acctgaaagc acatggcttg cgatttgcca cgataaacgc       240
     ggttataaaa agcaccctca ttttcaagta ggactttttg ataattattt gttcatctgg       300
     ctcgctttta tttatgaaaa tgaagaaagc acaaaaatcg ccaatcgctt tttgaaagaa       360
     aagaaactac ttgctgaatt acctgataca tttgcgattt cgccagacca tacggaagag       420
     aaaacttacc cggtgcacgg cggtcaactt gacgcaacgc ttaaacgttt ccgtgatgta       480
     aaaaaaggtg aatttttggt tggaaaaatt tatctacctg acgataacca tttatcccct       540
     ggaaaagact tcatcaaaga ggctgaaatg gtacttgatg agcttattcc gctttataag       600
     gctgctcttc aataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page