(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1054

AL596167.LIN1054     Location/Qualifiers
FT   CDS_pept        106013..106786
FT                   /transl_table=11
FT                   /gene="lin1054"
FT                   /note="similar to extragenic suppressor protein SuhB and to
FT                   myo-inositol-1(or 4)-monophosphatase"
FT                   /db_xref="GOA:Q92CW7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW7"
FT                   /protein_id="CAC96285.1"
FT                   /translation="MDSEKIDYLARLWIMEAAAKIKQSFKETLDIDIKSGRNDLVTNMD
FT                   KETEAFFVKQIKDHFPNHRLFGEEGMSDDVTDLNGIVWILDPIDGTLNFVEQQRDFAIS
FT                   LAIYQDGVGHLAYIYDVTRDELYFAEKGKGATVNGKQIPKIDKDMDLQDALLIANLSVT
FT                   RKFPTMWEAVKVSRGLRLHGAASLEYMDVATGRAGAYLSANLAPWDIAAGKIIVEELGG
FT                   IVTRIDGSKINMLEKGSSIVATPKIHQTLLDNYLP"
     atggacagcg aaaaaataga ttatttagca aggttatgga ttatggaagc agcagcaaaa        60
     atcaaacaat cttttaaaga aacattagac attgatataa agtctggccg aaatgattta       120
     gtgacaaaca tggataaaga aacagaagct ttttttgtca aacaaatcaa agaccatttt       180
     ccaaaccatc gcttatttgg agaagaaggt atgtcagatg atgtgaccga tttaaatgga       240
     attgtttgga ttcttgatcc aatcgacggc acacttaatt ttgtggagca acaacgagat       300
     tttgccattt cacttgcaat ttatcaagat ggagtagggc acttggctta tatttatgat       360
     gttactcgtg atgaactata cttcgcggaa aaaggaaaag gcgcaacagt aaatggcaaa       420
     caaattccta aaatcgataa agacatggat ttgcaagatg cactactaat tgccaatcta       480
     agtgtgacaa gaaaatttcc aactatgtgg gaagccgtaa aagtctcaag agggctacga       540
     cttcacggag cagcttcact tgaatatatg gacgttgcaa ccgggcgagc aggggcatat       600
     ctttcggcta atttagctcc gtgggatatt gctgctggaa aaattatcgt ggaagaatta       660
     gggggaattg tcacccgaat tgacggctca aaaatcaata tgctggaaaa aggaagttcc       720
     atcgttgcaa caccaaaaat tcatcaaacc ctattagaca actacctgcc ttaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page