(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1058

AL596167.LIN1058     Location/Qualifiers
FT   CDS_pept        110336..110617
FT                   /transl_table=11
FT                   /gene="lin1058"
FT                   /note="similar to B. subtilis YlaN protein"
FT                   /db_xref="InterPro:IPR009983"
FT                   /db_xref="InterPro:IPR036270"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CW3"
FT                   /protein_id="CAC96289.1"
FT                   /translation="MANKKIDHREEAIELLKQDAKRILQLIKVQMDNLTLPQCPAYEEV
FT                   LDTQMYGLSREINFATRLGLIEPEEGKKLISTLEKELSALHELSMSKK"
     atggcaaata aaaagataga tcacagagaa gaggcaattg agcttttaaa acaagacgca        60
     aaacgaatct tacagttgat taaagttcaa atggataatt taacattacc gcaatgtcca       120
     gcatatgaag aagttcttga tacacagatg tatggcttat cccgtgaaat taattttgca       180
     acccgcctag gactaattga accggaagaa ggaaaaaaat taatttccac actggagaaa       240
     gaattatccg cgctacatga actttccatg agcaaaaaat aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page