(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1059

AL596167.LIN1059     Location/Qualifiers
FT   CDS_pept        110790..111992
FT                   /transl_table=11
FT                   /gene="lin1059"
FT                   /note="similar to cell-division protein RodA and FtsW"
FT                   /db_xref="GOA:Q92CW2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW2"
FT                   /protein_id="CAC96290.1"
FT                   /translation="MLKRILKSYDYAFIAVFIVLCLFGIIMIYSASWSLAIGKDLPADY
FT                   YYARQVKNFIISFIFFVLFALIPFKFYQNNKVLMLIVFGSIGVLLLIFLVGKTVNNANS
FT                   WLVVGPRSLQPGEFAKLAVIIYMSAIYAKKQSYIDDFNRGVLPPIFFLAFVCFLIAIQP
FT                   DTGTAFIIFLVGCCIIIASGMRLRTIMKLIGIGVGVIVALTLILFALPDKVRTEIVSPT
FT                   KVARITTFMNPFEYADKEGHQLINSFYAIGSGGVSGQGLGESVQKLGYLPEAHTDFIIA
FT                   VVAEELGVFGVMFIILALFFIIFKTISTGLRAKDPFASLMCYGIASLIAIQAFINLGGA
FT                   SGLIPLTGVTLPFISYGGSSLMVLSMMLGIVANISMFNKYHRLYSADGSKKEVPKKQKR
FT                   R"
     atgttaaaac gaattttaaa atcatatgat tatgcattta ttgctgtttt tatagtgctt        60
     tgtttatttg gaattataat gatttatagt gcaagctggt ctctagctat tggtaaagat       120
     ttacctgctg actactatta tgcacgccaa gtaaaaaact ttataattag ttttattttc       180
     tttgttcttt ttgcgcttat cccttttaag ttttatcaaa acaataaagt tcttatgtta       240
     attgtatttg gctcaatcgg tgttttgtta ctgattttct tagttgggaa gacggtgaat       300
     aatgcgaata gttggctagt agttggacca cgttcacttc aacccgggga atttgcaaaa       360
     ttagctgtca ttatttatat gtctgcaatt tatgcgaaaa agcaaagtta cattgatgac       420
     tttaaccgcg gtgttttgcc accaatattc ttccttgctt ttgtttgttt cttgattgcg       480
     attcaaccgg atacaggtac tgcgtttatt attttccttg ttggttgttg tattattatt       540
     gcttctggga tgagacttcg aacaattatg aaactaattg gaattggagt cggggtcatt       600
     gtcgccctta cactaatttt gttcgcttta ccagataaag tcagaacgga aatcgtatca       660
     ccaacaaaag tagcgcggat tacgaccttt atgaatccgt ttgaatacgc agataaagaa       720
     ggacatcaac taattaattc cttttatgca ataggttcag gtggtgtttc tgggcaaggt       780
     ctcggcgaaa gtgttcagaa gctaggctat ttacctgaag cgcataccga ttttattatt       840
     gctgtagttg cagaagaatt aggtgtgttt ggcgtaatgt tcattatttt agcgctgttt       900
     ttcattattt ttaaaacgat ttctaccgga ctcagggcga aagatccttt tgcttcatta       960
     atgtgctacg ggattgcaag tttgattgct attcaagcat ttattaattt aggcggtgca      1020
     agtggactta tcccgctaac tggggtaaca cttccattta tcagttacgg tggttcttca      1080
     ttaatggttc tttccatgat gcttggaatt gtagcaaata tttcgatgtt taataaatat      1140
     caccgtttgt atagtgcaga tggttctaaa aaagaagttc ccaaaaagca aaaaagacga      1200
     tag                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page