(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1061

AL596167.LIN1061     Location/Qualifiers
FT   CDS_pept        115860..116753
FT                   /transl_table=11
FT                   /gene="lin1061"
FT                   /note="similar to metal binding protein (ABC transporter)"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW0"
FT                   /protein_id="CAC96292.1"
FT                   /translation="MKWFKGIAVALLLVILTACGNTETKAPTEKTKKIEVKDATEQKIT
FT                   LKEAPTKIVSLIPSNTEILFALDLGDKVKGVSAYDDYPKEAQKIEKVTSTTVDTEKIIA
FT                   LKPDLVLGHESMLATEKDAYQLLKDAGINVFVVPDATNLKEVENSIETIGKLTGKEQKA
FT                   KDVTASMEKQKAAVEKKVKELKTSPKVWIEISPDLYTAGKGTFMNEMLELAGGTNIVTE
FT                   TGFIPYNEEKVVELKPDIILSVYPDAKATILKRAAWKDLPAVKNEQIFEMDANKLSRPG
FT                   PRLLEGAADIQAVFEN"
     atgaaatggt ttaaaggaat tgccgtagca ttattacttg tgattttaac tgcatgcggg        60
     aatactgaaa caaaagcgcc aacagaaaaa acaaagaaaa ttgaagtgaa agatgcaaca       120
     gagcaaaaaa tcactttaaa agaagcacca acaaaaattg tttcattaat accgagtaac       180
     actgaaattt tatttgcgct cgatttggga gataaagtaa aaggtgtttc ggcttacgat       240
     gactatccta aagaagctca aaaaatcgaa aaagtcactt caactactgt agacactgaa       300
     aaaattatcg cacttaaacc agatttagta cttggtcatg agtctatgct tgccactgaa       360
     aaagacgctt atcaattact caaagatgca ggaattaatg tgtttgtcgt gccagatgca       420
     actaatttaa aagaagtcga aaattccatt gaaacaattg gtaaattaac tggaaaagag       480
     caaaaagcaa aagacgtaac tgcctcgatg gagaaacaaa aagccgcagt tgaaaagaaa       540
     gtcaaagagc tgaaaacatc tccaaaagtg tggattgaaa ttagcccaga cttatataca       600
     gcaggcaaag gaacgtttat gaatgaaatg cttgaacttg ctggtggtac aaatatcgtt       660
     accgaaactg gttttattcc atacaatgaa gaaaaagttg tagaattaaa accggatatt       720
     attttatccg tttatccaga tgcaaaagca actattttaa aacgcgctgc atggaaagac       780
     cttccagctg ttaaaaatga acagattttt gaaatggatg cgaataaatt aagtcgtcca       840
     ggtccaagat tattagaagg tgcagcagat attcaagcag tttttgaaaa ctaa             894
//

If you have problems or comments...

PBIL Back to PBIL home page