(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1062

AL596167.LIN1062     Location/Qualifiers
FT   CDS_pept        117035..117838
FT                   /transl_table=11
FT                   /gene="lin1062"
FT                   /note="highly similar to teichoic acid translocation
FT                   permease protein TagG "
FT                   /db_xref="GOA:Q92CV9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CV9"
FT                   /protein_id="CAC96293.1"
FT                   /translation="MKQVMEVIKEQIKNLPMIFRIARYEDKATYQSHYLGLAWQILNPL
FT                   IQIAIYYFVFGFGMNAKSGSDASYIEWMLAGIIPWFFISAVILQGANSIYNKIGMVSKM
FT                   NFPMSILPNITIVSNLTSYFTMMVILLGLLALNGTPVTIYWGQYLYYFVAMIAFLFSVT
FT                   LFNATISVLVRDYYIMLQSVMRVLFYVTGIVWNLETMLPQWLVHLLKLNPIYYVVNGFR
FT                   ETFLMNRGFWESPSYTMYFWLITLTLLFVGATLHMKFRERFVDYL"
     gtgaaacaag ttatggaagt tattaaagaa caaattaaaa atttaccaat gatatttcgc        60
     attgcgcgct atgaagataa ggctacatat caaagtcatt atctagggct agcttggcag       120
     attttaaacc cattaatcca aattgctatt tattatttcg tgtttggatt cggtatgaat       180
     gcaaaatctg gttctgatgc aagttatatt gaatggatgc tggctgggat tattccttgg       240
     ttctttatta gtgcggttat tttacaaggt gcgaatagta tttataataa aataggtatg       300
     gtttcaaaaa tgaatttccc aatgagtatt ttaccgaata taacgattgt ttctaattta       360
     actagctact ttacgatgat ggtaattttg cttggattac ttgccttaaa tggaactcct       420
     gttacgattt attggggcca atatttgtat tattttgtag caatgattgc ttttttattt       480
     agtgttacat tatttaatgc aactattagt gttttagtta gagattatta tattatgttg       540
     caatccgtta tgcgtgtact tttctatgta acggggattg tttggaattt agaaactatg       600
     ttgccacaat ggttagttca tttattaaaa ttaaatccaa tatactatgt ggttaatggt       660
     tttagggaaa cattcttaat gaatagaggt ttttgggaat ctccgtccta cacgatgtat       720
     ttctggttga ttacactaac actattattt gttggagcga cactgcacat gaaattccgt       780
     gaacgcttcg tggattattt atag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page