(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1063

AL596167.LIN1063     Location/Qualifiers
FT   CDS_pept        117851..118858
FT                   /transl_table=11
FT                   /gene="lin1063"
FT                   /note="similar to teichoic acid translocation ATP-binding
FT                   protein TagH (ABC transporter)"
FT                   /db_xref="GOA:Q92CV8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015860"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CV8"
FT                   /protein_id="CAC96294.1"
FT                   /translation="MGKNIKIAFKHVSKEYDLYQNKSDKIKGLFMPKSQKMQSFWALRD
FT                   VSFDIHDGETVGLIGINGSGKSTISSIMSGVIPPTQGEVVINGETSLIAIAVGLKGPLT
FT                   GYENIRLKLLMHGMKSSQINKLMPSIIEFADIGDFINQPIKNYSSGMRSRLGFAISVHT
FT                   NPDILVIDEALSVGDQTFYEKCVNKINEFKARGKTIVFVSHSLGQVKSLCDRIIWMHHG
FT                   EIREMGEAKEVAQKYDEFVKWFNKQPNDYKKKYQKEHKEHQKAPQKKVYPNPNANKYRL
FT                   TLFDKFLLTALIVLTILFGTLVATGKSFKGLISETSTNQVEQIAYVDNNEITIR"
     atgggtaaaa atattaaaat agcatttaaa catgtgtcga aagaatatga cctctatcaa        60
     aataaatcag acaagattaa aggcttgttc atgccgaaaa gtcaaaaaat gcaatccttt       120
     tgggctttac gagacgtttc ttttgatatt catgatggtg aaacagttgg tttaatcggg       180
     attaatggtt ccggtaagtc gactatttct agtattatgt caggtgttat cccgccaaca       240
     caaggcgaag tcgttattaa cggggaaact tcattaattg ccattgcagt agggttaaaa       300
     ggcccgttga caggttatga gaacatccgc ttaaaattac ttatgcatgg tatgaaaagt       360
     tcccaaatta acaaactaat gcctagtatt attgaatttg ctgatattgg cgatttcatt       420
     aaccaaccaa ttaaaaacta ttcgagtggt atgcgttcac gtctaggttt tgcaatttcc       480
     gtgcatacta accctgatat tttggttatt gatgaagctt tatccgtagg ggaccaaact       540
     ttttatgaaa aatgtgttaa taaaataaat gaatttaaag cacgtggaaa aactatcgtc       600
     tttgtcagtc actcacttgg acaagttaaa agtttgtgtg acagaatcat ctggatgcat       660
     cacggcgaaa tacgtgaaat gggcgaggcg aaagaagttg ctcaaaaata tgatgaattt       720
     gtaaaatggt ttaacaaaca accaaatgac tacaagaaaa aatatcaaaa agaacacaaa       780
     gaacatcaaa aagctccaca gaaaaaggtt tatcctaatc caaatgctaa caagtatcga       840
     ttaactctgt ttgataaatt tcttttaaca gctttaattg ttttaaccat attatttgga       900
     actttagtag caactggtaa atctttcaaa ggtttaatta gcgaaacctc aactaaccaa       960
     gtcgagcaaa ttgcatatgt agacaacaat gaaataacga tacgctaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page